Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

AA Sequence

MRGSCERSGEDEEQKEEAMVACGRLSGVPEAEQGPEANWDSDLETEGTDGLGELVRDTLYLRSCRAHSVV      1 - 70
PISCFLRQGSAQELNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDV     71 - 140
DLSENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGET    141 - 210
LGPALAENTGLTELNVSWNHLRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEEL    211 - 280
NMSNNRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDNPASALELLDFSDIQVNAEFD    281 - 350
GLASSVRGILPELCIKTGACRVEYKKELLPVFRSALPASVPK                                351 - 392
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.