Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.1e-10

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.1e-10

AA Sequence

MRGSCERSGEDEEQKEEAMVACGRLSGVPEAEQGPEANWDSDLETEGTDGLGELVRDTLYLRSCRAHSVV      1 - 70
PISCFLRQGSAQELNLRHRGLGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDV     71 - 140
DLSENQLGVAGAQALCAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGET    141 - 210
LGPALAENTGLTELNVSWNHLRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEEL    211 - 280
NMSNNRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDNPASALELLDFSDIQVNAEFD    281 - 350
GLASSVRGILPELCIKTGACRVEYKKELLPVFRSALPASVPK                                351 - 392
//

Text Mined References (4)

PMID Year Title