Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.4e-08
atypical teratoid / rhabdoid tumor 5112 3.8e-04
medulloblastoma 720 6.2e-03

AA Sequence

MNVRILRRHLVFPFIFIVIKELTLEGTPMNVNNLENPLDAPQNFKCMQGLSVEKPYKCKKCEKAFNNLSS      1 - 70
FQIHERMHRGGKYHACKGSGNTYRFSGFYHRHKMPHAGGKFYGCKKCGKAFISFCAFRYHQRTHTKEKPY     71 - 140
ACKQCGKAYISYTSFQYHQLNHTGAKCYECKQCGKGFDLPNSIRYHEMTHTGEKPHECKQCGKTFRCASS    141 - 210
LRIHGRTHTGEKPYECKQCGKVSRYWSGLQVHEVTHIGKKLYECKECGKSYYSSGSFLNHKRIHTREKSY    211 - 280
ECKECGKAFGNPISFQKHEGSHRKWKPYECKECGKVFSFSSSLRRHERTHTEKLCECKQHGKGFFHRSCP    281 - 350
RHMKIDTGEILHKRKIRGKVFHSPSSFQTCERSHTREKRYKCKQCGKPFIYFNAFQRHQRSHTGENPYEC    351 - 420
KQCGKACISSTAFQCRELSHTGAKRYKCKQCGKGFNLPSSIRYHEMTHTGEKPYECKQCGRAFRSASHLR    421 - 490
THERTHIGEKPYECKQCGKVYRYWSGLRIHGLTHIGKKPYEFNDRGKSFYSSNFFLNHKRVHTRVKTYEC    491 - 560
KECGKAFDNPTSFQKHEGSHRKGKSYECKECGKVFSFSRSFRRYERAHTGEKPCE                   561 - 615
//

Text Mined References (6)

PMID Year Title