Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MNVRILRRHLVFPFIFIVIKELTLEGTPMNVNNLENPLDAPQNFKCMQGLSVEKPYKCKKCEKAFNNLSS      1 - 70
FQIHERMHRGGKYHACKGSGNTYRFSGFYHRHKMPHAGGKFYGCKKCGKAFISFCAFRYHQRTHTKEKPY     71 - 140
ACKQCGKAYISYTSFQYHQLNHTGAKCYECKQCGKGFDLPNSIRYHEMTHTGEKPHECKQCGKTFRCASS    141 - 210
LRIHGRTHTGEKPYECKQCGKVSRYWSGLQVHEVTHIGKKLYECKECGKSYYSSGSFLNHKRIHTREKSY    211 - 280
ECKECGKAFGNPISFQKHEGSHRKWKPYECKECGKVFSFSSSLRRHERTHTEKLCECKQHGKGFFHRSCP    281 - 350
RHMKIDTGEILHKRKIRGKVFHSPSSFQTCERSHTREKRYKCKQCGKPFIYFNAFQRHQRSHTGENPYEC    351 - 420
KQCGKACISSTAFQCRELSHTGAKRYKCKQCGKGFNLPSSIRYHEMTHTGEKPYECKQCGRAFRSASHLR    421 - 490
THERTHIGEKPYECKQCGKVYRYWSGLRIHGLTHIGKKPYEFNDRGKSFYSSNFFLNHKRVHTRVKTYEC    491 - 560
KECGKAFDNPTSFQKHEGSHRKGKSYECKECGKVFSFSRSFRRYERAHTGEKPCE                   561 - 615
//

Text Mined References (3)

PMID Year Title
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.