Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 5.93372692090407E-14
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

AA Sequence

AVPTSAKSPVFSDVPFLTGQKMLPKHLQGGKFPPTK                                     1541 - 1576

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.