Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.9e-14
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6

AA Sequence

AVPTSAKSPVFSDVPFLTGQKMLPKHLQGGKFPPTK                                     1541 - 1576

Text Mined References (1)

PMID Year Title