Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.81
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.019 0.015
pilocytic astrocytoma 1.100 0.000
ovarian cancer -2.400 0.000

Synonym

Accession Q6ZPD9 Q68DC7 Q6ZTB7 Q6ZTS2
Symbols

Gene

Gene RIF (2)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with dpy-19-like 3 (DPY19L3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19488044 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MMSIRQRREIRATEVSEDFPAQEENVKLENKLPSGCTSRRLWKILSLTIGGTIALCIGLLTSVYLATLHE      1 - 70
NDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFL     71 - 140
SILYRVLPIQKYLEPVYFYIYTLFGLQAIYVTALYITSWLLSGTWLSGLLAAFWYVTNRIDTTRVEFTIP    141 - 210
LRENWALPFFAIQIAAITYFLRPNLQPLSERLTLLAIFISTFLFSLTWQFNQFMMLMQALVLFTLDSLDM    211 - 280
LPAVKATWLYGIQITSLLLVCILQFFNSMILGSLLISFNLSVFIARKLQKNLKTGSFLNRLGKLLLHLFM    281 - 350
VLCLTLFLNNIIKKILNLKSDEHIFKFLKAKFGLGATRDFDANLYLCEEAFGLLPFNTFGRLSDTLLFYA    351 - 420
YIFVLSITVIVAFVVAFHNLSDSTNQQSVGKMEKGTVDLKPETAYNLIHTILFGFLALSTMRMKYLWTSH    421 - 490
MCVFASFGLCSPEIWELLLKSVHLYNPKRICIMRYSVPILILLYLCYKFWPGMMDELSELREFYDPDTVE    491 - 560
LMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSF    561 - 630
GTDYVILEDSICYERRHRRGCRLRDLLDIANGHMMDGPGENDPDLKPADHPRFCEEIKRNLPPYVAYFTR    631 - 700
VFQNKTFHVYKLSRNK                                                          701 - 716
//

Text Mined References (8)

PMID Year Title
26764097 2016 Identification of DPY19L3 as the C-mannosyltransferase of R-spondin1 in human cells.
19488044 2009 Genome-wide association study of bipolar disorder in European American and African American individuals.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16526957 2006 Duplication and relocation of the functional DPY19L2 gene within low copy repeats.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.