Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.15
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.8e-06
Astrocytoma, Pilocytic 3081 1.8e-05
active Crohn's disease 922 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 1.4

Expression

  Differential Expression (3)

Disease log2 FC p
active Crohn's disease 1.019 1.5e-02
Astrocytoma, Pilocytic 1.100 1.8e-05
ovarian cancer -2.400 1.8e-06

Gene RIF (3)

AA Sequence

MMSIRQRREIRATEVSEDFPAQEENVKLENKLPSGCTSRRLWKILSLTIGGTIALCIGLLTSVYLATLHE      1 - 70
NDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLVQGFHGLIYDNKTESMKTINLLQRMNIYQEVFL     71 - 140
SILYRVLPIQKYLEPVYFYIYTLFGLQAIYVTALYITSWLLSGTWLSGLLAAFWYVTNRIDTTRVEFTIP    141 - 210
LRENWALPFFAIQIAAITYFLRPNLQPLSERLTLLAIFISTFLFSLTWQFNQFMMLMQALVLFTLDSLDM    211 - 280
LPAVKATWLYGIQITSLLLVCILQFFNSMILGSLLISFNLSVFIARKLQKNLKTGSFLNRLGKLLLHLFM    281 - 350
VLCLTLFLNNIIKKILNLKSDEHIFKFLKAKFGLGATRDFDANLYLCEEAFGLLPFNTFGRLSDTLLFYA    351 - 420
YIFVLSITVIVAFVVAFHNLSDSTNQQSVGKMEKGTVDLKPETAYNLIHTILFGFLALSTMRMKYLWTSH    421 - 490
MCVFASFGLCSPEIWELLLKSVHLYNPKRICIMRYSVPILILLYLCYKFWPGMMDELSELREFYDPDTVE    491 - 560
LMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYEDSSLRERTRAVYQIYAKRAPEEVHALLRSF    561 - 630
GTDYVILEDSICYERRHRRGCRLRDLLDIANGHMMDGPGENDPDLKPADHPRFCEEIKRNLPPYVAYFTR    631 - 700
VFQNKTFHVYKLSRNK                                                          701 - 716
//

Text Mined References (8)

PMID Year Title