Property Summary

NCBI Gene PubMed Count 5
Grant Count 7
R01 Count 7
Funding $403,726
PubMed Score 75.66
PubTator Score 15.39

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.100 0.000

AA Sequence

MAFFSRLNLQEGLQTFFVLQWIPVYIFLGAIPILLIPYFLLFSKFWPLAVLSLAWLTYDWNTHSQGGRRS      1 - 70
AWVRNWTLWKYFRNYFPVKLVKTHDLSPKHNYIIANHPHGILSFGVFINFATEATGIARIFPSITPFVGT     71 - 140
LERIFWIPIVREYVMSMGVCPVSSSALKYLLTQKGSGNAVVIVVGGAAEALLCRPGASTLFLKQRKGFVK    141 - 210
MALQTGAYLVPSYSFGENEVFNQETFPEGTWLRLFQKTFQDTFKKILGLNFCTFHGRGFTRGSWGFLPFN    211 - 280
RPITTVVGEPLPIPRIKRPNQKTVDKYHALYISALRKLFDQHKVEYGLPETQELTIT                 281 - 337
//

Text Mined References (5)

PMID Year Title
20374941 2010 Comparative genomics and proteomics of vertebrate diacylglycerol acyltransferase (DGAT), acyl CoA wax alcohol acyltransferase (AWAT) and monoacylglycerol acyltransferase (MGAT).
15772651 2005 The DNA sequence of the human X chromosome.
15671038 2005 Identification of two novel human acyl-CoA wax alcohol acyltransferases: members of the diacylglycerol acyltransferase 2 (DGAT2) gene superfamily.
14970677 2003 Genomic organization of the DGAT2/MOGAT gene family in cattle (Bos taurus) and other mammals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.