Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

AA Sequence

MWPAPCSVGRLLIFFMCSSSGYVVQGCGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQ      1 - 70
LIFWSLNAGLDLYLCLISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPP     71 - 140
CHRTDI                                                                    141 - 146
//

Text Mined References (3)

PMID Year Title
21255413 2011 A novel neuron-enriched protein SDIM1 is down regulated in Alzheimer's brains and attenuates cell death induced by DNAJB4 over-expression in neuro-progenitor cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.