Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

AA Sequence

MWPAPCSVGRLLIFFMCSSSGYVVQGCGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQ      1 - 70
LIFWSLNAGLDLYLCLISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPP     71 - 140
CHRTDI                                                                    141 - 146
//

Text Mined References (3)

PMID Year Title