Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0

Synonym

Accession Q6ZP68
Symbols SMABLO1
C13orf35

Gene

 Compartment GO Term (0)

AA Sequence

MNSPEARLCVAQCRDSYPGCQPLKDTRAWASSLKMDPAGLEGGPRDESRDEPPIRAQAASWDQPQGCLTY      1 - 70
KGRRSASGTQKQLQLPDTLSSLLCWRGAIMVYIKVTVQTDDSNKLLSLLYR                        71 - 121
//

Text Mined References (3)

PMID Year Title