Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.13
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 1.2e-04
Disease Target Count Z-score Confidence
Cystinosis 14 3.985 2.0
Batten disease 13 3.574 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.2e-04

Gene RIF (1)

AA Sequence

MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKAYKTGNMDQAL      1 - 70
SLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYKFRTRPSLLSAPINSVLLFLM     71 - 140
GMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQEVIGFVIGSISSVLYLLSRLPQIRTNFLRK    141 - 210
STQGISYSLFALVMLGNTLYGLSVLLKNPEEGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRST    211 - 280
AASELEPLLPS                                                               281 - 291
//

Text Mined References (8)

PMID Year Title