Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.200 0.000
Breast cancer 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q6ZNR8
Symbols PRR17
NCRNA00176

Gene

 Compartment GO Term (0)

AA Sequence

MEEAPLPKLAGLLLSQFPPTPTPPSSLPSPGAQYPPVHLVPGSDPARGGGRGPPRGPGESCLDRGCAHRG      1 - 70
GDAAPLQDAAPAEPAAQDAPCPASRRPKAAPAARPGRRRHLLGEALRAARPGLQGLLARPVLALRGEENQ     71 - 140
RGRGRAWRRASFCRLVGDLGPSLDAARAPRRAQDLEKGARLAAAGSRRRPALHAPKASINGAGAAGPALP    141 - 210
SPASLWA                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.