Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZNR8
Symbols PRR17
LINC00176
NCRNA00176

 Compartment GO Term (0)

AA Sequence

MEEAPLPKLAGLLLSQFPPTPTPPSSLPSPGAQYPPVHLVPGSDPARGGGRGPPRGPGESCLDRGCAHRG      1 - 70
GDAAPLQDAAPAEPAAQDAPCPASRRPKAAPAARPGRRRHLLGEALRAARPGLQGLLARPVLALRGEENQ     71 - 140
RGRGRAWRRASFCRLVGDLGPSLDAARAPRRAQDLEKGARLAAAGSRRRPALHAPKASINGAGAAGPALP    141 - 210
SPASLWA                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title