Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-03
Astrocytoma, Pilocytic -1.100 7.0e-04
glioblastoma -1.300 1.2e-04
group 3 medulloblastoma 1.200 2.6e-02
osteosarcoma -3.640 6.4e-12
ovarian cancer -1.100 2.1e-07
psoriasis -1.400 8.9e-27

Synonym

Accession Q6ZNR0 C9J9D1 C9JZ62 C9K046 Q6P434
Symbols DSPC3
IFITMD6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVE      1 - 70
DMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRA     71 - 140
FLLGVLAVGLGVCTYAAALVTLAAYLASRDPP                                          141 - 172
//

Text Mined References (9)

PMID Year Title