Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.64
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.276 0.002
non-small cell lung cancer -2.079 0.000
lung adenocarcinoma -2.000 0.000
lung carcinoma -1.900 0.000
Breast cancer 1.100 0.001
ductal carcinoma in situ -1.200 0.002
invasive ductal carcinoma -1.500 0.004
pancreatic cancer 1.200 0.002

Gene RIF (3)

PMID Text
22922960 FGD5 regulates endothelial adhesion, survival, and angiogenesis by modulating phosphatidylinositol 3-kinase signaling.
22661514 FGD5 inhibits neovascularization, indicated by in vitro tube-formation, aortic-ring, and coated-bead assays and by in vivo coated-bead plug assays and studies in the murine retina model.
22328776 Suggest that FGD5 regulates proangiogenic action of VEGF in vascular endothelial cells, including network formation, permeability, directional movement, and proliferation.

AA Sequence

MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLPCVDRGLDEGPRSIPKCSESETDEDYIVVPR      1 - 70
VPLREDEPKDEGSVGNKALVSPESSAEEEEEREEGGEACGLEGTGAGEDSVAPAAPGAGALSREGEEGTD     71 - 140
LALEDEGEGCADEPGTLEQVSRSEEEEKLVQPHRECSLEDSGPWAGEGVFQSDLLLPHIHGEDQEPPDTP    141 - 210
GEAEEDDEEGCASTDPAGADEGSGPDRPTEDMGQDAEDTSEEPPEKEELAGVQEAETATDCPEVLEEGCE    211 - 280
EATGVTGGEQVDLSEPPDHEKKTNQEVAAATLEDHAQDESAEESCQIVPFENDCMEDFVTSLTGSPYEFF    281 - 350
PTESTSFCSESCSPLSESAKGLESEQAPKLGLRAEENPMVGALCGQCGSLQGGAAEGPAAPDVVVVLEEE    351 - 420
ALDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEELNCEAEGGLVPADRKNTSTRVRPHSGKVA    421 - 490
GYVPETVPEETGPEAGSSAPGIGGAAEEVGKTLLSLEGKPLEASRALPAKPRAFTLYPRSFSVEGREIPV    491 - 560
SVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNHLPSSGTSTPSSMVDIPPPFDLACITKKPIT    561 - 630
KSSPSLLIESDSPDKYKKKKSSFKRFLALTFKKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSL    631 - 700
SNSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSAD    701 - 770
TSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDA    771 - 840
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQELLSSEKAYVEM    841 - 910
LQHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGILEELEERLSNWESQQKVADVF    911 - 980
LAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVREFEQSVQGGSQTAKHRLLRVVQRLFQYQVLL    981 - 1050
TDYLNNLCPDSAEYDNTQGALSLISKVTDRANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTL   1051 - 1120
MKVTGKNRRPRHLFLMNDVLLYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSAS   1121 - 1190
SCAERDEWYGCLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLR   1191 - 1260
RHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSFPLSSPRFSGS   1261 - 1330
AFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHWKKLWFVIKGKVLYTYMASED   1331 - 1400
KVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYSFKAEDTNSAQRWIEAMEDASVL           1401 - 1462
//

Text Mined References (10)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22922960 2012 Facio-genital dysplasia-5 regulates matrix adhesion and survival of human endothelial cells.
22661514 2012 Endothelial cell-specific FGD5 involvement in vascular pruning defines neovessel fate in mice.
22328776 2012 FGD5 mediates proangiogenic action of vascular endothelial growth factor in human vascular endothelial cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.