Property Summary

NCBI Gene PubMed Count 4
Grant Count 4
R01 Count 4
Funding $299,650.4
PubMed Score 2.43
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession Q6ZNK6 Q5H8A9
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
26458771 TIFAB loss increases TRAF6 protein and the dynamic range of TLR4 signaling

AA Sequence

MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSLEPYLEKGSAL      1 - 70
LAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRP     71 - 140
EAEETDEWEGISQGQPPPGSG                                                     141 - 161
//

Text Mined References (4)

PMID Year Title
26458771 2015 Loss of Tifab, a del(5q) MDS gene, alters hematopoiesis through derepression of Toll-like receptor-TRAF6 signaling.
15047173 2004 TIFAB inhibits TIFA, TRAF-interacting protein with a forkhead-associated domain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.