Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.93
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 6.6e-29
osteosarcoma 7950 2.7e-08
interstitial cystitis 2312 7.3e-03
Disease Target Count Z-score Confidence
MYELODYSPLASTIC SYNDROME 53 3.647 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.300 7.3e-03
osteosarcoma -1.672 2.7e-08
psoriasis 1.200 6.6e-29

Gene RIF (1)

AA Sequence

MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSLEPYLEKGSAL      1 - 70
LAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRP     71 - 140
EAEETDEWEGISQGQPPPGSG                                                     141 - 161
//

Text Mined References (5)

PMID Year Title