Property Summary

NCBI Gene PubMed Count 2
PubMed Score 14.41
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
acute myeloid leukemia 780

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.600 0.011

Synonym

Accession Q6ZNI0 Q9HCV8
Symbols gcnt
C20orf105
dJ1153D9.2

Gene

PANTHER Protein Class (2)

AA Sequence

MSQLRATKSGLVVRAVICIFIFLYLRNPTPAESEEEPAQPEVVECGFYPDELCSALFEGKGAAPQIAKFC      1 - 70
KTPHKSEIHAHLHTPGNCSRISRGLHFITRPLSAEEGDFSLAYIITIHKELAMFVQLLRAIYVPQNVYCI     71 - 140
HVDEKAPMKYKTAVQTLVNCFENVFISSKTEKVAYAGFTRLQADINCMKVLVHSKFQWNYVINLCGQDFP    141 - 210
IKTNREIIHYIRSKWSDKNITPGVIQPLHIKSKTSQSHLEFVPKGSIYAPPNNRFKDKPPHNLTIYFGSA    211 - 280
YYVLTRKFVEFILTDIHAKDMLQWSKDIRSPEQHYWVTLNRLKDAPGATPNAGWEGNVRAIKRKSEEGNV    281 - 350
HDGCKGRYVEDICVYGPGDLPWLIQSPSLFANKFEPSTDPLVVTCLERRHRLQVLRQAEVPIEPHWHFQQ    351 - 420
QSHFNMRLNR                                                                421 - 430
//

Text Mined References (4)

PMID Year Title
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.