Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 7.0e-08
group 4 medulloblastoma 1855 6.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.700 6.8e-03
osteosarcoma -1.797 7.0e-08

AA Sequence

MESPRGWTLQVAPEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGP      1 - 70
GRELGPADGGRDGAGPRSEPADRALRPSPLPEEPGCRCGECGKAFSQGSYLLQHRRVHTGEKPYTCPECG     71 - 140
KAFAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQLIHHQETHSGLKPFRCPDCGKSFGRSTTLVQHRR    141 - 210
THTGEKPYECPECGKAFSWNSNFLEHRRVHTGARPHACRDCGKAFSQSSNLAEHLKIHAGARPHACPDCG    211 - 280
KAFVRVAGLRQHRRTHSSEKPFPCAECGKAFRESSQLLQHQRTHTGERPFECAECGQAFVMGSYLAEHRR    281 - 350
VHTGEKPHACAQCGKAFSQRSNLLSHRRTHSGAKPFACADCGKAFRGSSGLAHHRLSHTGERPFACAECG    351 - 420
KAFRGSSELRQHQRLHSGERPFVCAHCSKAFVRKSELLSHRRTHTGERPYACGECGKPFSHRCNLNEHQK    421 - 490
RHGGRAAP                                                                  491 - 498
//

Text Mined References (4)

PMID Year Title