Property Summary

NCBI Gene PubMed Count 4
PubMed Score 16.32
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 5.6e-228
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.7
Disease Target Count Z-score Confidence
Cervix uteri carcinoma in situ 16 3.253 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.700 5.6e-228

Gene RIF (1)

AA Sequence

MHPLPGYWSCYCLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPL      1 - 70
PLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFG     71 - 140
DLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERY    141 - 210
NFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANKNRAARPW    211 - 280
IITMGHRPMYCSNADLDDCTRHESKVRKGLQGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFN    281 - 350
GSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHIHIQQVSDDQDGK    351 - 420
IVDDVWVVRPLFGRRMYL                                                        421 - 438
//

Text Mined References (7)

PMID Year Title