Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
R01 Count 5
Funding $929,540
PubMed Score 15.62
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.700 0.000

Gene RIF (1)

PMID Text
25032264 PAPL, IL10RB and DEPDC5 polymorphisms have an impact on progression of hepatitis B virus-related liver disease.

AA Sequence

MHPLPGYWSCYCLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWVPTRSEVQFGLQPSGPL      1 - 70
PLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFG     71 - 140
DLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERY    141 - 210
NFSNYKARFSMPGDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANKNRAARPW    211 - 280
IITMGHRPMYCSNADLDDCTRHESKVRKGLQGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFN    281 - 350
GSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHIHIQQVSDDQDGK    351 - 420
IVDDVWVVRPLFGRRMYL                                                        421 - 438
//

Text Mined References (7)

PMID Year Title
25032264 2014 Role of IFN-ks, IFN-ks related genes and the DEPDC5 gene in Hepatitis B virus-related liver disease.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
16793224 2006 Identification and molecular modeling of a novel, plant-like, human purple acid phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.