Property Summary

NCBI Gene PubMed Count 30
Grant Count 26
R01 Count 15
Funding $1,769,914.6
PubMed Score 34.99
PubTator Score 26.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -2.122 0.000
spina bifida -1.383 0.043
acute myeloid leukemia 2.000 0.041
ovarian cancer -2.200 0.000

Gene RIF (13)

PMID Text
25686604 data suggest an autophagy-specific membrane fusion mechanism in which oligomeric ATG14 directly binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion
24337183 Cisplatin upregulated Barkor protein levels of the Saos-2 cell line.
23878393 Atg14 is critical in controlling an autophagy-dependent phosphorylation of beclin-1. We map novel phosphorylation sites to serines 90 and 93 and demonstrate that phosphorylation at these sites is necessary for maximal autophagy.
23197835 Anaplasma actively induces autophagy by secreting Ats-1 that hijacks the Beclin 1-Atg14L autophagy initiation pathway likely to acquire host nutrients for its growth
22992773 Atg14 is a new target gene of FoxOs and the core clock machinery, and this gene plays an important role in hepatic lipid metabolism
22797916 Our findings reveal that Atg14L, previously considered to be solely a Beclin 1-binding autophagy protein, plays a novel role in the late stage of endocytic trafficking in conjunction with Snapin
22314358 analysis of how the Beclin1 coiled-coil domain interface regulates homodimer and heterodimer formation with Atg14L and UVRAG
20713597 Data suggest that the Atg14L-dependent appearance of phosphatidylinositol 3-phosphate in the endoplasmic reticulum makes this organelle the platform for autophagosome formation.
19460752 Knockdown of ATG14 autophagy related 14 homolog (S. cerevisiae, ATG14) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19270696 Two Beclin 1 associated proteins, Atg14L and Rubicon, were identified.
More...

AA Sequence

MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGR      1 - 70
DRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEG     71 - 140
LLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEE    141 - 210
VKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYY    211 - 280
SWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKK    281 - 350
LNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG    351 - 420
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTG    421 - 490
HR                                                                        491 - 492
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25686604 2015 ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24337183 2014 Silencing of Barkor/ATG14 sensitizes osteosarcoma cells to cisplatin?induced apoptosis.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23878393 2013 Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy.
More...