Property Summary

NCBI Gene PubMed Count 38
PubMed Score 38.60
PubTator Score 26.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.3e-13
osteosarcoma 7950 1.0e-06
psoriasis 6694 5.0e-04
acute myeloid leukemia 783 4.1e-02
spina bifida 1074 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Vici syndrome 14 3.568 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 2.000 4.1e-02
osteosarcoma -2.122 1.0e-06
ovarian cancer -2.200 1.3e-13
psoriasis -1.500 5.0e-04
spina bifida -1.383 4.3e-02

 GO Function (1)

Gene RIF (18)

AA Sequence

MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGR      1 - 70
DRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEG     71 - 140
LLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEE    141 - 210
VKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYY    211 - 280
SWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKK    281 - 350
LNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESG    351 - 420
DERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTG    421 - 490
HR                                                                        491 - 492
//

Text Mined References (40)

PMID Year Title