Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.90
PubTator Score 4.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.500 0.000

Synonym

Accession Q6ZNC8 A9EDQ5 B4DL59 B4E3J4 Q86XC2 Q8N9R5 LPLAT 1
Symbols LPLAT
LPSAT
OACT1
LPEAT1
LPLAT 1
dJ434O11.1

Gene

PANTHER Protein Class (2)

AA Sequence

MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATI      1 - 70
FGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSG     71 - 140
PLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFI    141 - 210
EGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPA    211 - 280
RLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWN    281 - 350
IQTATWLKCVCYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA    351 - 420
VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSIN    421 - 490
KRKTD                                                                     491 - 495
//

Text Mined References (17)

PMID Year Title
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
24489884 2014 Genome-wide association study of proneness to anger.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18772128 2008 Lysophospholipid acyltransferases and arachidonate recycling in human neutrophils.
18718904 2009 Acyl-CoA:lysophospholipid acyltransferases.
18287005 2008 Discovery of a lysophospholipid acyltransferase family essential for membrane asymmetry and diversity.
More...