Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.62
PubTator Score 4.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cholestasis 155 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 7.6e-28
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 0.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.500 7.6e-28

AA Sequence

MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTSSDVRHAVATI      1 - 70
FGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTICHISRIYIFHYGILTTDFSG     71 - 140
PLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKPSFLEYLSYLLNFMSVIAGPCNNFKDYIAFI    141 - 210
EGKHIHMKLLEVNWKRKGFHSLPEPSPTGAVIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPA    211 - 280
RLCYLYVVMQASKPKYYFAWTLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWN    281 - 350
IQTATWLKCVCYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA    351 - 420
VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQRRPQTLNSIN    421 - 490
KRKTD                                                                     491 - 495
//

Text Mined References (17)

PMID Year Title