Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.31
PubTator Score 1.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis -1.480 1.6e-02
Atopic dermatitis -1.100 4.3e-04
atypical teratoid / rhabdoid tumor -1.100 3.3e-02
glioblastoma 1.100 2.9e-03
group 3 medulloblastoma 1.500 1.9e-03
head and neck cancer -1.100 1.7e-02
interstitial cystitis -1.300 4.3e-04
intraductal papillary-mucinous carcinoma... -1.100 4.5e-02
intraductal papillary-mucinous neoplasm ... -1.200 1.6e-03
lung adenocarcinoma -1.200 1.1e-11
medulloblastoma, large-cell 1.900 9.7e-05
non-small cell lung cancer -1.088 7.7e-07
osteosarcoma 3.200 4.8e-08
ovarian cancer -1.100 1.7e-02
Pick disease 1.300 2.1e-05
primitive neuroectodermal tumor 1.100 3.7e-04
psoriasis -1.200 8.3e-15
subependymal giant cell astrocytoma -2.458 4.7e-02

AA Sequence

MTFTFQSEDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQKRKVVSSNIDV      1 - 70
PPARKSSEELDMDKVTAAMVLTSLSTSPLVRSPPVRPNESLSGSWKEGGCVPSSTSSSGYWSWSAPSDQS     71 - 140
NPSTPSPPLSADSFKPFRSPAQPDDGIDEAEASNLLFDEPIPRKRKNSMKVMFKCLWKNCGKVLSTAAGI    141 - 210
QKHIRTIHLGRVGDSDYSDGEEDFYYTEIKLNTDSVADGLSSLAPVSPSQSLASPPTFPIPDSSRTETPC    211 - 280
AKTETKLMTPLSRSAPTTLYLVHTDHAYQATPPVTIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHH    281 - 350
PVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCTACRWKKACQRFLD            351 - 412
//

Text Mined References (5)

PMID Year Title