Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.31
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholestasis 155 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.1e-03
group 3 medulloblastoma 4104 2.6e-03
Breast cancer 3578 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
ENSP00000256078 30 0.0 0.6
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Specific language impairment 34 5.804 2.9

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 3.200 4.0e-02
group 3 medulloblastoma 1.100 2.6e-03
ovarian cancer 1.700 1.1e-03

Gene RIF (2)

AA Sequence

MEASWRQVAGGRGRSRGRATAAPSGNGVHLRGAGGGREKGSVGAVPSGTSPGGVATTAAAGSRHSPAGSQ      1 - 70
ALQTTAASELMSQKKFEEIKKANQAAARKLVEEQFSSSSEEGDEDFEGKQGKILANTFITYTTQTDGDTR     71 - 140
ELERTKQYVNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKK    141 - 210
DCPWPCPKCRFEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCEREFKPPCGHKCLLLCHPGPCPP    211 - 280
CPKMVTTTCYCKKAKPIPRRCSAKEWSCQLPCGQKLLCGQHKCENPCHAGSCQPCPRVSRQKCVCGKKVA    281 - 350
ERSCASPLWHCDQVCGKTLPCGNHTCEQVCHVGACGECPRSGKRFCPCQKSKFSLPCTEDVPTCGDSCDK    351 - 420
VLECGIHRCSQRCHRGPCETCRQEVEKHCRCGKHTKRMPCHKPYLCETKCVKMRDCQKHQCRRKCCPGNC    421 - 490
PPCDQNCGRTLGCRNHKCPSVCHRGSCYPCPETVDVKCNCGNTKVTVPCGRERTTRPPKCKEQCSRPPTC    491 - 560
HHTSQEKHRCHFGSCPPCHQPCQKVLEKCGHLCPAPCHDQALIKQTGRHQPTGPWEQPSEPAFIQTALPC    561 - 630
PPCQVPIPMECLGKHEVSPLPCHAVGPYSCKRVCGRILDCQNHTCMKECHKVTKTDGCTGKNKAGPECLH    631 - 700
CEEGCSKSRPLGCLHPCILRCHPGECPPCVQMLRIKCHCKITSLYVECRKITTADVNEKNLLSCCKNQCP    701 - 770
KELPCGHRCKEMCHPGECPFNCNQKVKLRCPCKRIKKELQCNKVRENQVSIECDTTCKEMKRKASEIKEA    771 - 840
EAKAALEEEKRRQQAELEAFENRLKGRRKKNRKRDEVAVELSLWQKHKYYLISVCGVVVVVFAWYITHDV    841 - 910
N//

Text Mined References (17)

PMID Year Title