Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZNB5 TrpC2-like protein
Symbols

Gene

 GO Function (1)

 GO Component (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MAPVKISHVVSFSSQDPKYPVENLLNPDSPRRPWLGCPQDKSGQLKVELQLERAVPTGYIDVGNCGCAFL      1 - 70
QIDVGHSSWPLDRPFITLLPATTLMSLTDSKQGKNRSGVRMFKDGKEGKSRKDGGGLYEKQRCSTKEDCE     71 - 140
CY                                                                        141 - 142
//

Text Mined References (1)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.