Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.61
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 4.82565417028362E-28
osteosarcoma 7933 0.0011139595056816
Disease Target Count Z-score Confidence
multidrug-resistant tuberculosis 7 4.572 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.290 0.001
lung carcinoma -2.700 0.000

Synonym

Accession Q6ZNA5 A6NLN7
Symbols SDR2
SDFR2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAVSGFTLGTCILLLHISYVANYPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRPGDQIEVTLSG      1 - 70
HPFKGFLLEARNAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRSASKKTEIKVYWNAPSSAPNHT     71 - 140
QFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPLPTLPPVSHLTKPFSASDCGNKKFCIRSPLN    141 - 210
CDPEKEASCVFLSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSH    211 - 280
PVMDSRDTLEDMAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDGRIYKHSQQPLITYE    281 - 350
KYDVTDSPKNIGGSHSVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFT    351 - 420
TTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAAR    421 - 490
IIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLEVHAYRLSRKVEILDDDRIQILQSFTAVE    491 - 560
TEGHAFKKAVLAIYVCGNVTFLIIFLSAINHL                                          561 - 592
//

Text Mined References (7)

PMID Year Title
23218918 2013 White matter integrity as an intermediate phenotype: exploratory genome-wide association analysis in individuals at high risk of bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16169296 2005 Cytochrome b561 protein family: expanding roles and versatile transmembrane electron transfer abilities as predicted by a new classification system and protein sequence motif analyses.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499595 2003 Stromal cell-derived receptor 2 and cytochrome b561 are functional ferric reductases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.