Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.94
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 4.8e-28
osteosarcoma 7950 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
multidrug-resistant tuberculosis 7 4.549 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -2.700 4.8e-28
osteosarcoma -1.290 1.1e-03

Gene RIF (1)

AA Sequence

MAVSGFTLGTCILLLHISYVANYPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRPGDQIEVTLSG      1 - 70
HPFKGFLLEARNAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRSASKKTEIKVYWNAPSSAPNHT     71 - 140
QFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPLPTLPPVSHLTKPFSASDCGNKKFCIRSPLN    141 - 210
CDPEKEASCVFLSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSH    211 - 280
PVMDSRDTLEDMAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDGRIYKHSQQPLITYE    281 - 350
KYDVTDSPKNIGGSHSVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFT    351 - 420
TTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNWTHWSMGTAAR    421 - 490
IIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLEVHAYRLSRKVEILDDDRIQILQSFTAVE    491 - 560
TEGHAFKKAVLAIYVCGNVTFLIIFLSAINHL                                          561 - 592
//

Text Mined References (7)

PMID Year Title