Property Summary

NCBI Gene PubMed Count 41
Grant Count 12
R01 Count 10
Funding $1,600,432.2
PubMed Score 23.90
PubTator Score 33.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.025
ovarian cancer 1.600 0.003

 GWAS Trait (1)

Gene RIF (22)

PMID Text
26656854 Study reports that the monomeric RING domains from the human E3 ligases Arkadia and Ark2C bind directly to free ubiquitin with an affinity comparable to that of other dedicated ubiquitin-binding domains.
26238425 Results suggest that -459CpG methylation in Sp1-binding site of RNF111 promoter transcriptionally decreases RNF111 expression, which inhibits TGF-beta/Smad signaling associated invasion in NSCLC cells.
26151477 These data suggest that RNF111, together with the CRL4(DDB2) ubiquitin ligase complex, is responsible for sequential XPC ubiquitylation, which regulates the recruitment and release of XPC and is crucial for efficient progression of the NER reaction.
24912682 Arkadia can both promote and inhibit gene expression, indicating that Arkadia's activity in transcriptional control may depend on the epigenetic context, defined by Polycomb repressive complexes and DNA methylation.
23751493 Our findings establish RNF111 as a new STUbL that directly links nonproteolytic ubiquitylation and SUMOylation in the DNA damage response.
23530056 Arkadia is involved in arsenic-induced degradation of polysumoylated PML protein.
23467611 findings indicate that Arkadia is not critical for regulating tumor growth per se, but is required for the early stages of cancer cell colonization at the sites of metastasis
23394999 RNF111-dependent neddylation activates DNA damage-induced ubiquitination
23246292 We established that ARX polyA alterations damage the regulation of KDM5C expression.
23212909 FHL2 increases the stability of the TGF-beta pathway positive regulator Arkadia by inhibiting its ubiquitination and cooperates with Arkadia to activate TGF-beta signaling.
More...

AA Sequence

MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDD      1 - 70
SQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSS     71 - 140
PSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRL    141 - 210
PCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVS    211 - 280
ASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQ    281 - 350
GSSSHASRPQEPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSE    351 - 420
QASDTASAVTSSQPSTVSETSATLTSNSTTGTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGS    421 - 490
SQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVERPPQVQAPCGANSSSGTSYH    491 - 560
EQQALPVDLSNSGIRSHGSGSFHGASAFDPCCPVSSSRAAIFGHQAAAAAPSQPLSSIDGYGSSMVAQPQ    561 - 630
PQPPPQPSLSSCRHYMPPPYASLTRPLHHQASACPHSHGNPPPQTQPPPQVDYVIPHPVHAFHSQISSHA    631 - 700
TSHPVAPPPPTHLASTAAPIPQHLPPTHQPISHHIPATAPPAQRLHPHEVMQRMEVQRRRMMQHPTRAHE    701 - 770
RPPPHPHRMHPNYGHGHHIHVPQTMSSHPRQAPERSAWELGIEAGVTAATYTPGALHPHLAHYHAPPRLH    771 - 840
HLQLGALPLMVPDMAGYPHIRYISSGLDGTSFRGPFRGNFEELIHLEERLGNVNRGASQGTIERCTYPHK    841 - 910
YKKVTTDWFSQRKLHCKQDGEEGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCP    911 - 980
ICRVDIEAQLPSES                                                            981 - 994
//

Text Mined References (44)

PMID Year Title
26656854 2016 Secondary ubiquitin-RING docking enhances Arkadia and Ark2C E3 ligase activity.
26238425 2015 RNF111/Arkadia is regulated by DNA methylation and affects TGF-?/Smad signaling associated invasion in NSCLC cells.
26151477 2015 SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24912682 2014 Multiple Arkadia/RNF111 structures coordinate its Polycomb body association and transcriptional control.
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
23751493 2013 RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
23530056 2013 Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.
More...