Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZN92 dUTPase-like protein
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MPVIPALGEAKGEVLPPGDTTTIIPLNWMLKSPPGHFGLLLLLSQQAKNGVMVLAGVTDPEYQDEISLLL      1 - 70
HNEGHLKEVKMEGARLGLPGRAESLEHQVQSHLNMIAQSQRTFQKKDAGKAIILSKLTQEQKTKHCMFSL     71 - 140
H//

Text Mined References (1)

PMID Year Title