Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
cystic fibrosis -2.504 0.000
nasopharyngeal carcinoma -1.700 0.000
chronic rhinosinusitis -2.006 0.007

AA Sequence

MLDTIARALQDLGRQVLPTLPSLSQEEVSIIWGNVSEFVRRQLTLHKGVQIPAFGTFTFIRQKLEVGNNK      1 - 70
FILIQRPVFIMVEKLVQIHGLKQNKVYTPGEIPIVPLNFVMISLEGPFNRDVVEGCVKETLLFLSRSISM     71 - 140
KQNVEFTFKGIGVLMIRDSKVKMRFYKDFLCTMDGSGALAKALANRPGTVDSVLSSREALRKWPSSVLAF    141 - 210
PRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKEEGTRDISSPKRLRDRQALFPAKVTNVSLLEKF    211 - 280
ERSESGGKIMTPESLSYPSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEERRREIE    281 - 350
DERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSPAL    351 - 420
NALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQ    421 - 490
IKNKPSRLPPFEPDSSEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQR    491 - 560
TQREHLADRTAELERVNRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRT    561 - 630
SNVGESNLWPLNKFLPGSRLLV                                                    631 - 652
//

Text Mined References (6)

PMID Year Title
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.