Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.11
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.2e-11
nasopharyngeal carcinoma 1058 7.9e-08
cystic fibrosis 1696 7.4e-07
chronic rhinosinusitis 512 6.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -2.006 6.7e-03
cystic fibrosis -2.504 7.4e-07
ependymoma 2.900 1.2e-11
nasopharyngeal carcinoma -1.700 7.9e-08

AA Sequence

MLDTIARALQDLGRQVLPTLPSLSQEEVSIIWGNVSEFVRRQLTLHKGVQIPAFGTFTFIRQKLEVGNNK      1 - 70
FILIQRPVFIMVEKLVQIHGLKQNKVYTPGEIPIVPLNFVMISLEGPFNRDVVEGCVKETLLFLSRSISM     71 - 140
KQNVEFTFKGIGVLMIRDSKVKMRFYKDFLCTMDGSGALAKALANRPGTVDSVLSSREALRKWPSSVLAF    141 - 210
PRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKEEGTRDISSPKRLRDRQALFPAKVTNVSLLEKF    211 - 280
ERSESGGKIMTPESLSYPSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEERRREIE    281 - 350
DERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEKPEFYKSFLFDKRPLSPAL    351 - 420
NALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQ    421 - 490
IKNKPSRLPPFEPDSSEPIFGKNEGELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQR    491 - 560
TQREHLADRTAELERVNRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRT    561 - 630
SNVGESNLWPLNKFLPGSRLLV                                                    631 - 652
//

Text Mined References (6)

PMID Year Title