Property Summary

NCBI Gene PubMed Count 4
PubMed Score 120.90

Knowledge Summary

Patent

No data available

 GWAS Trait (1)

AA Sequence

MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLF      1 - 70
FIYGTYLSGTELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIAL     71 - 140
CLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSS    141 - 210
SLLMTWAIILKRNEIQKLGVSKLNCWLIQGSAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDF    211 - 280
DTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFKKTVGDISRVLATNVYLRCCLCRCHAYNGKC    281 - 350
QAVYTSSHCESSTLRRCRLEAWLQHA                                                351 - 376
//

Text Mined References (5)

PMID Year Title