Property Summary

NCBI Gene PubMed Count 4
PubMed Score 114.25

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZN68 Q8N9V4 Q8ND62
Symbols

Gene

AA Sequence

MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLF      1 - 70
FIYGTYLSGTELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIAL     71 - 140
CLSNVAFMLPWQFAQFILFTQIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSS    141 - 210
SLLMTWAIILKRNEIQKLGVSKLNCWLIQGSAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDF    211 - 280
DTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFKKTVGDISRVLATNVYLRCCLCRCHAYNGKC    281 - 350
QAVYTSSHCESSTLRRCRLEAWLQHA                                                351 - 376
//

Text Mined References (5)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16526957 2006 Duplication and relocation of the functional DPY19L2 gene within low copy repeats.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.