Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.18
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.12131064469059E-16
group 4 medulloblastoma 1875 9.83085831113022E-6
psoriasis 6685 3.81416833410734E-4
lung cancer 4473 0.00234017031961641

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.000
lung cancer -1.300 0.002
group 4 medulloblastoma 1.400 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q6ZN57 A5PLN5 B7ZM23 Q9H6Z6 Zfp-2
Symbols zfp-2
ZNF751

Gene

  Ortholog (5)

AA Sequence

MEREGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMV      1 - 70
KRPHNCNSHGEDATQNSELIKTQRMFVGKKIYECNQCSKTFSQSSSLLKHQRIHTGEKPYKCNVCGKHFI     71 - 140
ERSSLTVHQRIHTGEKPYKCNECGKAFSQSMNLTVHQRTHTGEKPYQCKECGKAFHKNSSLIQHERIHTG    141 - 210
EKPYKCNECGKAFTQSMNLTVHQRTHTGEKPYECNECGKAFSQSMHLIVHQRSHTGEKPYECSQCGKAFS    211 - 280
KSSTLTLHQRNHTGEKPYKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNECGKAFSKNSSLTQHRRIHTG    281 - 350
EKPYECMVCGKHFTGRSSLTVHQVIHTGEKPYECNECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFI    351 - 420
KNSSLTVHQRTHTGEKPYQCNECGKAFSRSTNLTRHQRTHT                                 421 - 461
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.