Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.18
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 4.1e-16
psoriasis 6694 3.8e-04
lung cancer 4740 2.3e-03
group 3 medulloblastoma 4104 3.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.6e-03
lung cancer -1.300 2.3e-03
lung carcinoma 1.100 4.1e-16
psoriasis -1.100 3.8e-04

AA Sequence

MEREGIWHSTLGETWEPNNWLEGQQDSHLSQVGVTHKETFTEMRVCGGNEFERCSSQDSILDTQQSIPMV      1 - 70
KRPHNCNSHGEDATQNSELIKTQRMFVGKKIYECNQCSKTFSQSSSLLKHQRIHTGEKPYKCNVCGKHFI     71 - 140
ERSSLTVHQRIHTGEKPYKCNECGKAFSQSMNLTVHQRTHTGEKPYQCKECGKAFHKNSSLIQHERIHTG    141 - 210
EKPYKCNECGKAFTQSMNLTVHQRTHTGEKPYECNECGKAFSQSMHLIVHQRSHTGEKPYECSQCGKAFS    211 - 280
KSSTLTLHQRNHTGEKPYKCNKCGKSFSQSTYLIEHQRLHSGVKPFECNECGKAFSKNSSLTQHRRIHTG    281 - 350
EKPYECMVCGKHFTGRSSLTVHQVIHTGEKPYECNECGKAFSQSAYLIEHQRIHTGEKPYECDQCGKAFI    351 - 420
KNSSLTVHQRTHTGEKPYQCNECGKAFSRSTNLTRHQRTHT                                 421 - 461
//

Text Mined References (4)

PMID Year Title