Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.85
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 4.31732148436524E-8
medulloblastoma 1524 3.04247507995702E-7
atypical teratoid / rhabdoid tumor 4369 4.01431486585893E-7
ovarian cancer 8492 1.33880984045308E-6
pediatric high grade glioma 2712 1.42843090646788E-6
glioblastoma 5572 7.93787812291859E-6
medulloblastoma, large-cell 6234 8.948137120433E-6
primitive neuroectodermal tumor 3031 3.23580857957319E-5
osteosarcoma 7933 0.00152266119660867
lung cancer 4473 0.00532829475717137
non primary Sjogren syndrome sicca 840 0.0141838880238451
astrocytoma 1493 0.0156391215144246

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.066 0.002
astrocytoma -1.100 0.016
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.000
tuberculosis 1.500 0.000
lung cancer 1.100 0.005
pediatric high grade glioma -1.300 0.000
non primary Sjogren syndrome sicca 1.300 0.014
ovarian cancer -1.500 0.000

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (2)

Pathway (1)

AA Sequence

MAILSLRAPGPWQAMQVWADRTLLTPHTGVTSQVLGVAAAVMTPLPGGHAAGRTREARWDAMEYDEKLAR      1 - 70
FRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLA     71 - 140
SDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSV    141 - 210
KQTCDKCNTIIWGLIQTWYTCTGCYYRCHSKCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAE    211 - 280
CRAPISLRGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRL    281 - 350
REINPLLFSYVEELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAG    351 - 420
RLGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDCYYDNSTTCP    421 - 490
KCARLSLRKQSLFQEPGPDVEA                                                    491 - 512
//

Text Mined References (6)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.