Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.11
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 2.7e-04
astrocytoma -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.400 4.0e-07
glioblastoma -1.500 7.9e-06
lung cancer 1.100 5.3e-03
medulloblastoma -1.200 3.0e-07
medulloblastoma, large-cell -1.900 8.9e-06
non primary Sjogren syndrome sicca 1.300 1.4e-02
osteosarcoma -1.066 1.5e-03
ovarian cancer -1.500 1.3e-06
primitive neuroectodermal tumor -1.100 3.2e-05
tuberculosis 1.500 4.3e-08

AA Sequence

MAILSLRAPGPWQAMQVWADRTLLTPHTGVTSQVLGVAAAVMTPLPGGHAAGRTREARWDAMEYDEKLAR      1 - 70
FRQAHLNPFNKQSGPRQHEQGPGEEVPDVTPEEALPELPPGEPEFRCPERVMDLGLSEDHFSRPVGLFLA     71 - 140
SDVQQLRQAIEECKQVILELPEQSEKQKDAVVRLIHLRLKLQELKDPNEDEPNIRVLLEHRFYKEKSKSV    141 - 210
KQTCDKCNTIIWGLIQTWYTCTGCYYRCHSKCLNLISKPCVSSKVSHQAEYELNICPETGLDSQDYRCAE    211 - 280
CRAPISLRGVPSEARQCDYTGQYYCSHCHWNDLAVIPARVVHNWDFEPRKVSRCSMRYLALMVSRPVLRL    281 - 350
REINPLLFSYVEELVEIRKLRQDILLMKPYFITCREAMEARLLLQLQDRQHFVENDEMYSVQDLLDVHAG    351 - 420
RLGCSLTEIHTLFAKHIKLDCERCQAKGFVCELCREGDVLFPFDSHTSVCADCSAVFHRDCYYDNSTTCP    421 - 490
KCARLSLRKQSLFQEPGPDVEA                                                    491 - 512
//

Text Mined References (6)

PMID Year Title