Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.99
PubTator Score 5.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.18584474170632E-49
posterior fossa group B ependymoma 1530 2.61644918776058E-12
oligodendroglioma 2849 4.49043615977222E-12
atypical teratoid / rhabdoid tumor 4369 5.59494065302658E-10
glioblastoma 5572 6.62960742710538E-7
pediatric high grade glioma 2712 6.73333916754282E-6
primitive neuroectodermal tumor 3031 1.53200585948242E-5
medulloblastoma, large-cell 6234 1.70369361951325E-5
astrocytic glioma 2241 5.38311290954578E-4
ovarian cancer 8492 7.31195443466005E-4
group 4 medulloblastoma 1875 0.00201757799082076
Breast cancer 3099 0.00258707606110592
facioscapulohumeral dystrophy 286 0.00755276697842617
pilocytic astrocytoma 3086 0.00757229675176965
aldosterone-producing adenoma 664 0.00929483036443161
invasive ductal carcinoma 2950 0.0177349686962297
subependymal giant cell astrocytoma 2287 0.0293086902592854
pituitary cancer 1972 0.0296847287094938
Disease Target Count Z-score Confidence
Colorectal Cancer 62 3.833 1.9

Expression

  Differential Expression (18)

Synonym

Accession Q6ZN44 B2RXE6 Q8TF26 Q96GP4
Symbols UNC5H1

Gene

PANTHER Protein Class (1)

PDB

4V2A  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

 CSPA Cell Line (2)

Gene RIF (7)

PMID Text
24737586 these data suggest an important role for UNC5A, a candidate tumor suppressor, in predicting response to DNA damage induced by chemotherapeutic drug and regulating cell death in bladder cancer
24676280 FANCC interferes with UNC5A's functions in apoptosis and suggest that FANCC may participate in developmental processes through association with the dependence receptor UNC5A.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20372800 UNC5A is a novel transcriptional target of p53 and plays a role in p53-dependent apoptosis
19913121 Observational study of gene-disease association. (HuGE Navigator)
15573119 UNC5 orthologues define a new mechanism for both the positive (induction) and negative (suppression) regulation of apoptosis in cancer cells (review)
12655055 may represent tumor suppressor that inhibit tumor extension outside the region of netrin-1 availability by inducing apoptosis

AA Sequence

MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPA      1 - 70
TQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKA     71 - 140
YIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQ    141 - 210
ARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQG    211 - 280
TDLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQP    281 - 350
VSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAE    351 - 420
EFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRL    421 - 490
PLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSWEDVLHLGEEAPSHLYY    491 - 560
CQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEK    561 - 630
QLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPS    631 - 700
TSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPP    701 - 770
CRRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEA    771 - 840
EC                                                                        841 - 842
//

Text Mined References (16)

PMID Year Title
25374360 2014 FLRT structure: balancing repulsion and cell adhesion in cortical and vascular development.
24737586 2014 DNA damage-inducible gene, UNC5A, functions as a tumor-suppressor in bladder cancer.
24676280 2014 The Fanconi anemia group C protein interacts with uncoordinated 5A and delays apoptosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20372800 2010 Identification of UNC5A as a novel transcriptional target of tumor suppressor p53 and a regulator of apoptosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17174565 2007 Characterization of the receptors for axon guidance factor netrin-4 and identification of the binding domains.
15573119 2004 Netrin-1 and its receptors in tumorigenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...