Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.19
PubTator Score 5.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.300 2.1e-03
aldosterone-producing adenoma -1.088 9.3e-03
astrocytic glioma -2.000 5.4e-04
Astrocytoma, Pilocytic -1.200 4.8e-03
atypical teratoid / rhabdoid tumor -3.700 5.6e-10
Breast cancer 1.500 2.6e-03
ependymoma -2.700 1.3e-03
facioscapulohumeral dystrophy -1.800 7.6e-03
glioblastoma -2.700 5.0e-07
group 4 medulloblastoma -2.100 2.0e-03
invasive ductal carcinoma 1.600 1.8e-02
medulloblastoma, large-cell -2.600 1.7e-05
oligodendroglioma -1.400 1.6e-02
ovarian cancer 1.900 7.3e-04
pituitary cancer -1.600 3.0e-02
primitive neuroectodermal tumor -2.900 1.5e-05
psoriasis 2.000 1.2e-49
subependymal giant cell astrocytoma -3.490 2.9e-02

Gene RIF (8)

AA Sequence

MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPA      1 - 70
TQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKA     71 - 140
YIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQ    141 - 210
ARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQG    211 - 280
TDLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQP    281 - 350
VSIKPSKADNPHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAE    351 - 420
EFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRL    421 - 490
PLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSWEDVLHLGEEAPSHLYY    491 - 560
CQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEK    561 - 630
QLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPS    631 - 700
TSDLACKLWVWQVEGDGQSFSINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPP    701 - 770
CRRGADWRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEA    771 - 840
EC                                                                        841 - 842
//

Text Mined References (17)

PMID Year Title