Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.77
PubTator Score 24.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Disease log2 FC p
ovarian cancer -2.100 4.6e-11
acute quadriplegic myopathy 1.051 3.4e-05
adult high grade glioma 1.100 5.0e-03
Astrocytoma, Pilocytic 1.200 2.5e-03
atypical teratoid / rhabdoid tumor 1.200 2.2e-04
colon cancer -2.000 1.6e-03
ependymoma 1.200 4.8e-02
fibroadenoma -1.100 4.7e-02
glioblastoma 1.200 1.8e-03
group 3 medulloblastoma 3.300 2.7e-05
interstitial cystitis 1.300 9.6e-04
intraductal papillary-mucinous adenoma (... -1.100 1.4e-02
intraductal papillary-mucinous carcinoma... -1.100 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.200 4.5e-02
invasive ductal carcinoma 1.032 2.4e-02
lung cancer -2.300 3.1e-04
lung carcinoma -2.300 2.5e-24
malignant mesothelioma -3.900 5.3e-07
medulloblastoma, large-cell 1.300 1.5e-03
osteosarcoma 3.103 2.7e-04
pancreatic cancer 1.100 4.9e-03
pituitary cancer -1.100 7.2e-05
primary pancreatic ductal adenocarcinoma 1.180 3.9e-03
subependymal giant cell astrocytoma 1.389 4.1e-02

Gene RIF (25)

AA Sequence

MAHLGPTPPPHSLNYKSEDRLSEQDWPAYFKVPCCGVDTSQIESEEAEVDVRERETQRDREPKRARDLTL      1 - 70
RDSCTDNSMQFGTRTTTAEPGFMGTWQNADTNLLFRMSQQAIRCTLVNCTCECFQPGKINLRTCDQCKHG     71 - 140
WVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLG    141 - 210
WTLRDYVRGYILQDAAGKVLDRWAIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSSKTDS    211 - 280
DIRTFIESNNRTRSPSLLAHLENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPGL    281 - 350
RLREPSLSTQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHP    351 - 420
KSSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSSLRSRNRHS    421 - 490
ANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLALTSPGRPPMGFTTPPLDPVLQNPLPSQLVF    491 - 560
SGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTIEQHPPPPSEPVVPAVMMATHEPSADLAPK    561 - 630
KKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGAVVNDMSHDNHCHSQEEMSPGMSVKDFSKHNRTRCI    631 - 700
SRTEIRRADSMTSEDQEPERDYENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQD    701 - 770
VIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKK    771 - 840
SFKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMGLDSSQPSLSK    841 - 910
DLRDEFLVKIYGAQHPMGLDVREDASSPAGTEDSHLNGYGRGMAEDYMVLDLSTTSSLQSSSSIHSSRES    911 - 980
DAGSDEGILLDDIDGASDSGESAHKAEAPALPGSLGAEVSGSLMFSSLSGSNGGIMCNICHKMYSNKGTL    981 - 1050
RVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTSVD                        1051 - 1099
//

Text Mined References (35)

PMID Year Title