Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.97
PubTator Score 24.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 2.46121372677975E-24
posterior fossa group A ependymoma 1511 1.35805519935162E-10
group 3 medulloblastoma 2254 2.61614492845811E-7
malignant mesothelioma 3163 5.28439595997641E-7
acute quadriplegic myopathy 1157 3.12908969024136E-6
atypical teratoid / rhabdoid tumor 4369 3.88831849982809E-5
pituitary cancer 1972 7.23210861331134E-5
adult high grade glioma 2148 8.20988772935899E-5
osteosarcoma 7933 2.66870311027958E-4
lung cancer 4473 3.13163520202345E-4
interstitial cystitis 2299 9.64575662087335E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00119150467455688
medulloblastoma, large-cell 6234 0.00150142587600103
colon cancer 1475 0.00156274940475456
pilocytic astrocytoma 3086 0.00251754674138149
invasive ductal carcinoma 2950 0.00305055967205017
glioblastoma 5572 0.00447850599835911
pancreatic cancer 2300 0.00489855360437468
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00730185542952767
primary pancreatic ductal adenocarcinoma 1271 0.0146106834545208
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0452787814258221
fibroadenoma 557 0.0473837011634426
subependymal giant cell astrocytoma 2287 0.0489956674242243
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
ovarian cancer 8492 0.0 2.0
Disease Target Count Z-score Confidence
Hypospadias 65 3.579 1.8

Expression

Synonym

Accession Q6ZN30 B1APG9 Q6T3A3 Q8NAR2 Q9H6J0 Q9NXV0
Symbols BSN2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (23)

PMID Text
26821013 Study indicates that BNC2 expression was down-regulated in hepatocellular tumors and cell lines showing a frequent gene deletion.
26211971 A functional SNP leading to increased expression in BNC2 is implicated in the etiology of Adolescent Idiopathic Scoliosis.
25705849 BNC2 gene mutation influencing facial pigmented spots.
24916375 Human skin color is influenced by an intergenic DNA polymorphism regulating transcription of the nearby BNC2 pigmentation gene.
24853948 follow-up studies are necessary to establish the role of BNC2 in blood-based DNA and epithelial ovarian cancer (EOC), including prospective studies to validate this region as a potential biomarker and predictor of EOC susceptibility
23052946 We identified two new skin color genes: genetic variants in UGT1A were significantly associated with hue and variants in BNC2 were significantly associated with saturation.
21750727 Data indicate that the SNPs are located in the region of the BNC2 gene which is involved in ovarian development.
21642636 results suggest that the analysed polymorphisms in the BNC2 gene are unlikely to contribute to the previously reported risk of ovarian cancer in women with endometriosis
21368915 The association of BNC2 disruption with distal urethral defects and the gene's expression pattern indicate that it functions in urethral development.
21294870 the 4 recently reported SNPs,located near BNC2, SORCS1, GSC and WDR72 loci, affecting glycemic control in type 1 diabetes had no apparent effect on HbA1c in type 2 diabetes; but, for SORCS1 SNP, findings do not rule out possible relationship with HbA1c
More...

AA Sequence

MAHLGPTPPPHSLNYKSEDRLSEQDWPAYFKVPCCGVDTSQIESEEAEVDVRERETQRDREPKRARDLTL      1 - 70
RDSCTDNSMQFGTRTTTAEPGFMGTWQNADTNLLFRMSQQAIRCTLVNCTCECFQPGKINLRTCDQCKHG     71 - 140
WVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLG    141 - 210
WTLRDYVRGYILQDAAGKVLDRWAIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVAVPSSKTDS    211 - 280
DIRTFIESNNRTRSPSLLAHLENSNPSSIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPGL    281 - 350
RLREPSLSTQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHP    351 - 420
KSSFRIHRMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSSLRSRNRHS    421 - 490
ANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLALTSPGRPPMGFTTPPLDPVLQNPLPSQLVF    491 - 560
SGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTIEQHPPPPSEPVVPAVMMATHEPSADLAPK    561 - 630
KKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGAVVNDMSHDNHCHSQEEMSPGMSVKDFSKHNRTRCI    631 - 700
SRTEIRRADSMTSEDQEPERDYENESESSEPKLGEESMEGDEHIHSEVSEKVLMNSERPDENHSEPSHQD    701 - 770
VIKVKEEFTDPTYDMFYMSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKK    771 - 840
SFKSSYSVKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMGLDSSQPSLSK    841 - 910
DLRDEFLVKIYGAQHPMGLDVREDASSPAGTEDSHLNGYGRGMAEDYMVLDLSTTSSLQSSSSIHSSRES    911 - 980
DAGSDEGILLDDIDGASDSGESAHKAEAPALPGSLGAEVSGSLMFSSLSGSNGGIMCNICHKMYSNKGTL    981 - 1050
RVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNPNLHKNIPFTSVD                        1051 - 1099
//

Text Mined References (32)

PMID Year Title
26821013 2016 Decreased Expression of BNC1 and BNC2 Is Associated with Genetic or Epigenetic Regulation in Hepatocellular Carcinoma.
26211971 2015 A Functional SNP in BNC2 Is Associated with Adolescent Idiopathic Scoliosis.
25705849 2015 A Genome-Wide Association Study Identifies the Skin Color Genes IRF4, MC1R, ASIP, and BNC2 Influencing Facial Pigmented Spots.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24916375 2014 Human skin color is influenced by an intergenic DNA polymorphism regulating transcription of the nearby BNC2 pigmentation gene.
24853948 2014 Genome-wide investigation of regional blood-based DNA methylation adjusted for complete blood counts implicates BNC2 in ovarian cancer.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23052946 2013 Comprehensive candidate gene study highlights UGT1A and BNC2 as new genes determining continuous skin color variation in Europeans.
21750727 2011 Genetic variation on 9p22 is associated with abnormal ovarian ultrasound results in the Prostate, Lung, Colorectal, and Ovarian Cancer Screening Trial.
21642636 2011 Ovarian cancer-associated polymorphisms in the BNC2 gene among women with endometriosis.
More...