Property Summary

NCBI Gene PubMed Count 77
Grant Count 5
R01 Count 5
Funding $3,293,779
PubMed Score 95.83
PubTator Score 96.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (71)

PMID Text
26936749 MACC1 was a specific target gene of miR-338-3p, which regulates malignant biological behaviors of glioma cells partly through directly silencing MACC1 expression.
26871844 Our results suggest that rs975263 and rs4721888 polymorphisms in MACC1 are associated with the risk of breast cancer susceptibility and may be involved in the progression of breast cancer in Chinese women
26719224 This study suggests that MACC1 is an independent prognostic factor in gastric adenocarcinoma and that the prognostic impact of MACC1 may be associated with MACC1 partners other than MET.
26681060 downregulation of MACC1 expression could enhance cisplatin sensitivity and decrease drug resistance in SKOV- 3/DDP cells.
26339359 Conclude that the ability of proliferation and invasion in T24 cells can be inhibited by RNAi-targeting MACC1.
26332389 Our findings suggest that MACC1 protein, as a valuable marker of cervical cancer prognosis, plays an important role in the progression of human cervical cancer cells.
26097569 In renal cell carcinoma, positive MACC1 expression was found to significantly correlate with distant metastasis and TNM stage. patients with higher MACC1 expression had a significantly lower disease-free rate
26090393 conclusion, high MACC1 expression may serve as a prognostic biomarker to guide individualized management in clinical practice for digestive system neoplasms.
26065229 MACC1 may serve as a new parameter for the prognostic prediction in patients with invasive breast carcinoma
26043756 the expression levels of MACC1 were significantly correlated with the biological processes underlying glioma cell proliferation, invasion and metastasis.
More...

AA Sequence

MLITERKHFRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQ      1 - 70
LSASNPFLDDITQLRNNRKRNNISILKEDPFLFCREIENGNSFDSSGDELDVHQLLRQTSSRNSGRSKSV     71 - 140
SELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQSPGWAQTQLA    141 - 210
EVTIACKVNHQGGSVQLPESDITVHVPQGHVAVGEFQEVSLRAFLDPPHMLNHDLSCTVSPLLEIMLGNL    211 - 280
NTMEALLLEMKIGAEVRKDPFSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAA    281 - 350
QAKALPSPAATIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNISPVVFQLW    351 - 420
GKQSFLLDKPQDLSISIFSCDPDFEVKTEGERKEIKQKQLEAGEVVHQQFLFSLVEHREMHLFDFCVQVE    421 - 490
PPNGEPVAQFSITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKYPTFQDKTLNFSNYGVTLKAV    491 - 560
LRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVGVLRGKIGLVHCKNVKVISKEQVMFMSDSVF    561 - 630
TTRNLLEQIVLPLKKLTYIYSVVLTLVSEKVYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKL    631 - 700
KEDCHTERNTRKFLYELIVALLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEI    701 - 770
PHRGNTGDVAVEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEV    771 - 840
LRVTAFSTSEEV                                                              841 - 852
//

Text Mined References (82)

PMID Year Title
26936749 2016 Mir-338-3p Inhibits Malignant Biological Behaviors of Glioma Cells by Targeting MACC1 Gene.
26871844 2016 Genetic Variation in Metastasis-Associated in Colon Cancer-1 and the Risk of Breast Cancer Among the Chinese Han Population: A STROBE-Compliant Observational Study.
26719224 2016 Increased MACC1 expression indicates a poor prognosis independent of MET expression in gastric adenocarcinoma.
26681060 2015 Downregulation of MACC1 expression enhances cisplatin sensitivity in SKOV-3/DDP cells.
26339359 2015 Targeting MACC1 by RNA interference inhibits proliferation and invasion of bladder urothelial carcinoma in T24 cells.
26332389 2015 Metastasis-Associated in Colon Cancer-1 Associates With Poor Prognosis and Promotes Cell Invasion and Angiogenesis in Human Cervical Cancer.
26097569 2015 Increased expression of metastasis-associated in colon cancer-1 in renal cell carcinoma is associated with poor prognosis.
26090393 2015 Prognostic Value of MACC1 in Digestive System Neoplasms: A Systematic Review and Meta-Analysis.
26065229 2015 Metastasis associated in colon cancer 1 predicts poor outcomes in patients with breast cancer.
26043756 2015 Silence of MACC1 expression by RNA interference inhibits proliferation, invasion and metastasis, and promotes apoptosis in U251 human malignant glioma cells.
More...