Property Summary

NCBI Gene PubMed Count 98
PubMed Score 107.29
PubTator Score 96.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Atopic dermatitis -1.200 9.6e-05
Breast cancer -1.400 5.7e-06
ductal carcinoma in situ 1.500 4.9e-02
interstitial cystitis -1.600 1.3e-02
intraductal papillary-mucinous adenoma (... 1.100 1.5e-03
intraductal papillary-mucinous carcinoma... 1.400 1.2e-02
intraductal papillary-mucinous neoplasm ... 2.100 1.7e-03
lung adenocarcinoma 1.700 8.3e-07
lung carcinoma -2.300 1.1e-14
ovarian cancer 2.200 9.4e-09
pancreatic cancer 1.200 1.4e-05
spina bifida -1.381 4.7e-02

Gene RIF (92)

AA Sequence

MLITERKHFRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQ      1 - 70
LSASNPFLDDITQLRNNRKRNNISILKEDPFLFCREIENGNSFDSSGDELDVHQLLRQTSSRNSGRSKSV     71 - 140
SELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQSPGWAQTQLA    141 - 210
EVTIACKVNHQGGSVQLPESDITVHVPQGHVAVGEFQEVSLRAFLDPPHMLNHDLSCTVSPLLEIMLGNL    211 - 280
NTMEALLLEMKIGAEVRKDPFSQVMTEMVCLHSLGKEGPFKVLSNCYIYKDTIQVKLIDLSQVMYLVVAA    281 - 350
QAKALPSPAATIWDYIHKTTSIGIYGPKYIHPSFTVVLTVCGHNYMPGQLTISDIKKGGKNISPVVFQLW    351 - 420
GKQSFLLDKPQDLSISIFSCDPDFEVKTEGERKEIKQKQLEAGEVVHQQFLFSLVEHREMHLFDFCVQVE    421 - 490
PPNGEPVAQFSITTPDPTPNLKRLSNLPGYLQKKEEIKSAPLSPKILVKYPTFQDKTLNFSNYGVTLKAV    491 - 560
LRQSKIDYFLEYFKGDTIALLGEGKVKAIGQSKVKEWYVGVLRGKIGLVHCKNVKVISKEQVMFMSDSVF    561 - 630
TTRNLLEQIVLPLKKLTYIYSVVLTLVSEKVYDWKVLADVLGYSHLSLEDFDQIQADKESEKVSYVIKKL    631 - 700
KEDCHTERNTRKFLYELIVALLKMDCQELVARLIQEAAVLTSAVKLGKGWRELAEKLVRLTKQQMEAYEI    701 - 770
PHRGNTGDVAVEMMWKPAYDFLYTWSAHYGNNYRDVLQDLQSALDRMKNPVTKHWRELTGVLILVNSLEV    771 - 840
LRVTAFSTSEEV                                                              841 - 852
//

Text Mined References (103)

PMID Year Title