Property Summary

NCBI Gene PubMed Count 96
PubMed Score 113.43
PubTator Score 94.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cell Transformation, Neoplastic 97 0.0 0.0
Neoplasms 63 0.0 0.0
Disease Target Count P-value
group 3 medulloblastoma 4104 1.4e-06
Astrocytoma, Pilocytic 3081 8.7e-06
glioblastoma 5792 3.1e-04
cystic fibrosis 1696 2.2e-03
medulloblastoma, large-cell 6241 4.8e-02
Disease Target Count Z-score Confidence
Neuroblastoma 80 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.104 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 8.7e-06
cystic fibrosis 1.900 2.2e-03
glioblastoma -1.300 3.1e-04
group 3 medulloblastoma 4.100 1.4e-06
medulloblastoma, large-cell 1.900 4.8e-02

 IMPC Phenotype (1)

Gene RIF (85)

AA Sequence

MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLF      1 - 70
MEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAK     71 - 140
ECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQEA    141 - 210
RAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKKT                                  211 - 250
//

Text Mined References (104)

PMID Year Title