Property Summary

NCBI Gene PubMed Count 84
Grant Count 46
R01 Count 21
Funding $3,205,313.99
PubMed Score 99.95
PubTator Score 94.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 4.100 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell 1.900 0.048
cystic fibrosis 1.900 0.002
pilocytic astrocytoma -1.200 0.000

Gene RIF (73)

PMID Text
27383785 let-7 disruption by LIN28B, MYCN sponging, or genetic loss is a unifying mechanism of neuroblastoma development with broad implications for cancer pathogenesis
26751131 suggest that molecular subtypes of the LIN-28B/let-7a/IGF-II axis associate with heterogeneous progression
26712910 elevated LIN28B expression as a hallmark of a novel fetal-like subgroup in Juvenile myelomonocytic leukemia.
26481147 Data show that RNA-binding protein LIN28B coordinates the expression of the oncogene RAN protein and aurora A kinase (AURKA) in neuroblastoma.
26158423 Testing for a combination of elevated IMP3 and Lin28B levels could further facilitate the identification of a patient subgroup with the worst prognosis.
26123663 LIN28B as an important effector of the MYCN oncogenic phenotype and underline the importance of MYCN-regulated miRNAs in establishing the MYCN-driven oncogenic process.
26080928 A functional link between Lin28B and the uridylation pathway with a focus on let-7 metabolism in cancer cells.
26071398 The data implicate Lin28B as a novel oncogene in melanomagenesis by mediating a miRNA regulatory circuit.
26028027 Lin28B/let-7 pathway is tightly regulated by macroH2A1
25925570 The study establishes that the ribonuclease DIS3, targeting LIN28B, sustains the maturation of let-7 miRNAs.
More...

AA Sequence

MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLF      1 - 70
MEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAK     71 - 140
ECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQEA    141 - 210
RAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKKT                                  211 - 250
//

Text Mined References (92)

PMID Year Title
27383785 2016 Multiple mechanisms disrupt the let-7 microRNA family in neuroblastoma.
26751131 2016 LIN-28B/let-7a/IGF-II axis molecular subtypes are associated with epithelial ovarian cancer prognosis.
26712910 2016 LIN28B overexpression defines a novel fetal-like subgroup of juvenile myelomonocytic leukemia.
26481147 2015 A LIN28B-RAN-AURKA Signaling Network Promotes Neuroblastoma Tumorigenesis.
26158423 2015 Overexpression of the RNA-binding proteins Lin28B and IGF2BP3 (IMP3) is associated with chemoresistance and poor disease outcome in ovarian cancer.
26123663 2015 MYCN-driven regulatory mechanisms controlling LIN28B in neuroblastoma.
26080928 2015 A role of uridylation pathway for blockade of let-7 microRNA biogenesis by Lin28B.
26071398 2015 Lin28B promotes melanoma growth by mediating a microRNA regulatory circuit.
26028027 2016 MacroH2A1 downregulation enhances the stem-like properties of bladder cancer cells by transactivation of Lin28B.
25925570 2015 The ribonuclease DIS3 promotes let-7 miRNA maturation by degrading the pluripotency factor LIN28B mRNA.
More...