Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZN03
Symbols C21orf136
NCRNA00322

Gene

 Compartment GO Term (0)

AA Sequence

MALLITPAGVATVNRHSTIPSDTHTSREKPRFHKPCRNDLESLLSEGRLDTSVQTPCPQHPHTQLSCEPQ      1 - 70
PLEHSSCLSTCLAGCFLPVPSSPHTHPLLPGSRWLPPPLALLMGTLSPGLAVKPSWVPRFPLLARQSPAT     71 - 140
SVGMPLSAATQPGSVGRLHFPKLRSSSPFSGHSDENKATGQGRENRDQPQRPSHLCECPEAAKQSATNGV    141 - 210
AETNRSVFPLGSEARSLSLRRQESQPHSGSSRRESVSCSPSFWCCWQPLAFLTCGCAAPISVPGVTRPSP    211 - 280
RPCCVSPPLVRLQSLGLGPTQI                                                    281 - 302
//

Text Mined References (4)

PMID Year Title
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.