Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.14
PubTator Score 2.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.7e-07
adrenocortical carcinoma 1428 3.7e-03
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Multiple Sclerosis 540 0.0 1.4

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma 1.151 3.7e-03
osteosarcoma 1.893 2.7e-07

AA Sequence

MTLAASSQRSQIIRSKFRSVLQLRIHRRNQEQISDPDPWISASDPPLAPALPSGTAPFLFSPGVLLPEPE      1 - 70
YCPPWRSPKKESPKISQRWRESKPRGNLTYHQYMPPEPRQGSRADPQAEGSALGPPGPSLWEGTDSQQPH     71 - 140
PRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLRGLPVSGTKSMLLERMRGGAPPRE    141 - 210
RPKPRREDSPAGAPWPRLKPKALAAARRQGSVKPSAASHRPPLPRAADTPGTAPAPTPTPAPAAAPALTP    211 - 280
SSGPGSAALTLEEELQEAIRRAQLLPNRGIDDILEDQVEPDDPLPPIPLDFPGSFDVLSPSPDSEGLSSV    281 - 350
FSSSLPSPTNSSSPSPRDPTDSLDWLEALSGGPPLGSGPPPPSIFSADLSDSSSSRLWDLLEDPW         351 - 415
//

Text Mined References (10)

PMID Year Title