Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.77
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.141 2.6e-02
Astrocytoma, Pilocytic 2.300 1.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.347 4.6e-03
breast carcinoma -1.900 7.4e-04
Down syndrome 1.100 4.6e-03
Duchenne muscular dystrophy 1.504 4.3e-07
ductal carcinoma in situ -2.000 3.6e-04
ependymoma 1.700 3.8e-07
fibroadenoma -2.600 4.5e-03
intraductal papillary-mucinous carcinoma... -1.200 1.8e-02
invasive ductal carcinoma -3.300 1.3e-04
limb girdle muscular dystrophy 2A 1.155 9.7e-06
lung adenocarcinoma -1.500 5.3e-14
lung cancer -2.400 5.3e-03
malignant mesothelioma 1.300 1.4e-04
medulloblastoma, large-cell -1.100 6.6e-03
non-small cell lung cancer -1.817 1.3e-15
osteosarcoma -1.289 2.0e-02
ovarian cancer -2.300 4.9e-08
pediatric high grade glioma 1.200 2.7e-02
progressive supranuclear palsy -1.100 1.3e-02
psoriasis -1.200 9.8e-06
spina bifida 1.267 3.0e-02
tuberculosis 1.100 3.6e-05

 GO Function (1)

Gene RIF (3)

AA Sequence

MTQQPQDDFDRSVEDAQAWMKAVQDQLQVNDNTQGPRAALEARLWETEKICQLEPEGRVRVDLVLRMAEA      1 - 70
LLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHI     71 - 140
ELQLGLKEKQWQLSHAQVLLHNVDNQAVLLDRLLEEAASLFNRIGDPSVDEDAQKRMKAEYDAVKAKAQK    141 - 210
RVDLLEQVAREHEEYQAGVDEFQLWLKAVVEKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLE    211 - 280
EQSAGVIRNTSPLGAEKITGELEEMRKVLEKLRALWEEEEERLRGLLRSRGAWEQQIKQLEAELSEFRMV    281 - 350
LQRLAQEGLQPAAKAGTEDELVAHWRRYSATRAALASEEPRVDRLQAQLKELIVFPHNLKPLSDSVIATI    351 - 420
QEYQSLKVKSARLRNAAAVELWQHFQRPLQDLQLWKALAQRLLEVTASLPDLPSLHTFLPQIEAALMESS    421 - 490
RLKELLTMLQLKKDLLIGIFGQERATALLEQVAGSMRDRDLLHNSLLQRKSKLQSLLAQHKDFGAAFEPL    491 - 560
QRKLLDLQVRVQAEKGLQRDLPGKQAQLSRLQGLQEEGLDLGAQMEAARPLVQENPNHQHKMDQLSSDFQ    561 - 630
ALQRSLEDLVDRCRQSVQEHCTFSHQLLELRQWIVVTTQKLEAHRGEAGPGDAESQEAEFERLVAEFPEK    631 - 700
EAQLSLVEAQGWLVMEKSSPEGAAVVQEELRELAESWRALRLLEESLLSLIRNWHLQRMEVDSGKKMVFT    701 - 770
NNIPKSGFLINPMDPIPRHRRRANLLQEEEGSHEDFSQLLRNFGQWLQVENSKLVRIIAMRTSTAEDLRT    771 - 840
RKSKLQELEARVPEGQHLFENLLRLGPARGTSDELEDLRYQWMLYKSKLKDSGHLLTQSSPGEPTGFQKT    841 - 910
RRWRGLGSLFRRACCVALPLQLLLLLFLLLLFLLPIREEDRSCTLANNFARSFTLMLRYNGPPPT         911 - 975
//

Text Mined References (16)

PMID Year Title