Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.74
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.34904808522909E-15
lung adenocarcinoma 2714 2.34952592732368E-10
posterior fossa group A ependymoma 1511 3.3374096888047E-9
ovarian cancer 8492 4.85929974875969E-8
pilocytic astrocytoma 3086 1.16370931906207E-7
Duchenne muscular dystrophy 602 4.34763267206388E-7
tuberculosis and treatment for 3 months 327 7.82646165194837E-6
limb girdle muscular dystrophy 2A 156 9.67371503028493E-6
psoriasis 6685 9.76391071197004E-6
lung cancer 4473 5.13805664980144E-5
invasive ductal carcinoma 2950 1.32799522035861E-4
malignant mesothelioma 3163 1.4250911541958E-4
ductal carcinoma in situ 1745 3.64563878149847E-4
breast carcinoma 1614 7.35714299125044E-4
fibroadenoma 557 0.00447660795259416
Down syndrome 548 0.00458393884780651
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00460850043629509
medulloblastoma, large-cell 6234 0.00661632788084179
progressive supranuclear palsy 674 0.0129062608338955
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0182784982992522
osteosarcoma 7933 0.0197516977606166
adrenocortical carcinoma 1427 0.0255506587778578
pediatric high grade glioma 2712 0.026512486485269
spina bifida 1064 0.0304361290098645

Expression

Synonym

Accession Q6ZMZ3 A6H8H3 Q86SX5 Q8N7G8
Symbols NET53
Nesp3
C14orf49
C14orf139
LINC00341
NCRNA00341

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (2)

PMID Text
21937718 nesprin-3 regulates vascular endothelial cell shape, perinuclear cytoskeletal architecture, and important aspects of flow-mediated mechanotransduction.
18827015 association with human nesprin-3 appeared to be stronger for torsinADeltaE than for torsinA. TorsinA also associated with the KASH domains of nesprin-1 and -2

AA Sequence

MTQQPQDDFDRSVEDAQAWMKAVQDQLQVNDNTQGPRAALEARLWETEKICQLEPEGRVRVDLVLRMAEA      1 - 70
LLACCPGDQKPGILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLLARDEFYRWFQKMMVTLEPHI     71 - 140
ELQLGLKEKQWQLSHAQVLLHNVDNQAVLLDRLLEEAASLFNRIGDPSVDEDAQKRMKAEYDAVKAKAQK    141 - 210
RVDLLEQVAREHEEYQAGVDEFQLWLKAVVEKVNGCLGRNCKLPITQRLSTLQDIAKDFPRGEESLETLE    211 - 280
EQSAGVIRNTSPLGAEKITGELEEMRKVLEKLRALWEEEEERLRGLLRSRGAWEQQIKQLEAELSEFRMV    281 - 350
LQRLAQEGLQPAAKAGTEDELVAHWRRYSATRAALASEEPRVDRLQAQLKELIVFPHNLKPLSDSVIATI    351 - 420
QEYQSLKVKSARLRNAAAVELWQHFQRPLQDLQLWKALAQRLLEVTASLPDLPSLHTFLPQIEAALMESS    421 - 490
RLKELLTMLQLKKDLLIGIFGQERATALLEQVAGSMRDRDLLHNSLLQRKSKLQSLLAQHKDFGAAFEPL    491 - 560
QRKLLDLQVRVQAEKGLQRDLPGKQAQLSRLQGLQEEGLDLGAQMEAARPLVQENPNHQHKMDQLSSDFQ    561 - 630
ALQRSLEDLVDRCRQSVQEHCTFSHQLLELRQWIVVTTQKLEAHRGEAGPGDAESQEAEFERLVAEFPEK    631 - 700
EAQLSLVEAQGWLVMEKSSPEGAAVVQEELRELAESWRALRLLEESLLSLIRNWHLQRMEVDSGKKMVFT    701 - 770
NNIPKSGFLINPMDPIPRHRRRANLLQEEEGSHEDFSQLLRNFGQWLQVENSKLVRIIAMRTSTAEDLRT    771 - 840
RKSKLQELEARVPEGQHLFENLLRLGPARGTSDELEDLRYQWMLYKSKLKDSGHLLTQSSPGEPTGFQKT    841 - 910
RRWRGLGSLFRRACCVALPLQLLLLLFLLLLFLLPIREEDRSCTLANNFARSFTLMLRYNGPPPT         911 - 975
//

Text Mined References (15)

PMID Year Title
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
23478653 2014 A genome-wide association study of survival in small-cell lung cancer patients treated with irinotecan plus cisplatin chemotherapy.
22518138 2012 Cytoskeletal interactions at the nuclear envelope mediated by nesprins.
21937718 2011 Nesprin-3 regulates endothelial cell morphology, perinuclear cytoskeletal architecture, and flow-induced polarization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18827015 2008 TorsinA binds the KASH domain of nesprins and participates in linkage between nuclear envelope and cytoskeleton.
18396275 2008 Structural requirements for the assembly of LINC complexes and their function in cellular mechanical stiffness.
16330710 2005 Nesprin-3, a novel outer nuclear membrane protein, associates with the cytoskeletal linker protein plectin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...