Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
Funding $377,750
PubMed Score 6.71
PubTator Score 6.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -1.200 0.002
psoriasis -2.100 0.000
adrenocortical carcinoma -1.176 0.004
tuberculosis and treatment for 3 months -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.090 0.014
lung cancer -2.500 0.004
Bipolar Disorder 1.400 0.046
acute myeloid leukemia 1.500 0.009
Gaucher disease type 1 1.400 0.006
pancreatic cancer 1.200 0.012

Synonym

Accession Q6ZMZ0 B7ZLB2 E9PAW6 G3XA82 Q0VG77 Q5TH44 Q5TH45 Q6P6A4 Q8N2S8 Q8WUF3
Symbols NKLAM
IBRDC3

Gene

PANTHER Protein Class (2)

AA Sequence

MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTLHSVFSASARGRRARAKPQAEPPPPAAQPPPAPAPA      1 - 70
AAQGPPPEALPAEPAAEAEAEAAAAAAEPGFDDEEAAEGGGPGAEEVECPLCLVRLPPERAPRLLSCPHR     71 - 140
SCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPD    141 - 210
CGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGP    211 - 280
ADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQ    281 - 350
LGTLIGAPVGISLIAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVS    351 - 420
VGIGVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGESSIEGLT    421 - 490
SVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQADVQKEIFPKDTASLGAI    491 - 560
SDNASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEGSGGGG    561 - 630
SEEDPPCRHQSCEQKDCLASKPWDISLAQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPR    631 - 700
AQGAPSPSAHMNLSALAEGQTVLKPEGGEARV                                          701 - 732
//

Text Mined References (12)

PMID Year Title
23269922 2012 Natural killer lytic-associated molecule plays a role in controlling tumor dissemination and metastasis.
23085241 2012 E3 ubiquitin ligase NKLAM is a macrophage phagosome protein and plays a role in bacterial killing.
19915045 2009 Impaired NK cytolytic activity and enhanced tumor growth in NK lytic-associated molecule-deficient mice.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16709802 2006 NK lytic-associated molecule, involved in NK cytotoxic function, is an E3 ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10912506 2000 Gene structure of human and mouse NKLAM, a gene associated with cellular cytotoxicity.
More...