Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.71
PubTator Score 6.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis and treatment for 3 months 327 4.45684996719778E-6
psoriasis 6685 6.4515319862203E-5
urothelial carcinoma 318 0.0018990746768284
adrenocortical carcinoma 1427 0.00366770049384051
lung cancer 4473 0.0044690747192819
Gaucher disease type 1 171 0.00586147391587546
acute myeloid leukemia 785 0.00939919098256409
pancreatic cancer 2300 0.0122487757685479
primary pancreatic ductal adenocarcinoma 1271 0.0136619212593558
Bipolar Disorder 266 0.0461691759094986
Disease Target Count Z-score Confidence
Avian influenza 8 3.418 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -1.200 0.002
psoriasis -2.100 0.000
adrenocortical carcinoma -1.176 0.004
tuberculosis and treatment for 3 months -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.090 0.014
lung cancer -2.500 0.004
Bipolar Disorder 1.400 0.046
acute myeloid leukemia 1.500 0.009
Gaucher disease type 1 1.400 0.006
pancreatic cancer 1.200 0.012

Synonym

Accession Q6ZMZ0 B7ZLB2 E9PAW6 G3XA82 Q0VG77 Q5TH44 Q5TH45 Q6P6A4 Q8N2S8 Q8WUF3
Symbols NKLAM
IBRDC3

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MGSEKDSESPRSTSLHAAAPDPKCRSGGRRRRLTLHSVFSASARGRRARAKPQAEPPPPAAQPPPAPAPA      1 - 70
AAQGPPPEALPAEPAAEAEAEAAAAAAEPGFDDEEAAEGGGPGAEEVECPLCLVRLPPERAPRLLSCPHR     71 - 140
SCRDCLRHYLRLEISESRVPISCPECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPD    141 - 210
CGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGP    211 - 280
ADDIKPCPRCSAYIIKMNDGSCNHMTCAVCGCEFCWLCMKEISDLHYLSPSGCTFWGKKPWSRKKKILWQ    281 - 350
LGTLIGAPVGISLIAGIAIPAMVIGIPVYVGRKIHSRYEGRKTSKHKRNLAITGGVTLSVIASPVIAAVS    351 - 420
VGIGVPIMLAYVYGVVPISLCRGGGCGVSTANGKGVKIEFDEDDGPITVADAWRALKNPSIGESSIEGLT    421 - 490
SVLSTSGSPTDGLSVMQGPYSETASFAALSGGTLSGGILSSGKGKYSRLEVQADVQKEIFPKDTASLGAI    491 - 560
SDNASTRAMAGSIISSYNPQDRECNNMEIQVDIEAKPSHYQLVSGSSTEDSLHVHAQMAENEEEGSGGGG    561 - 630
SEEDPPCRHQSCEQKDCLASKPWDISLAQPESIRSDLESSDAQSDDVPDITSDECGSPRSHTAACPSTPR    631 - 700
AQGAPSPSAHMNLSALAEGQTVLKPEGGEARV                                          701 - 732
//

Text Mined References (12)

PMID Year Title
23269922 2012 Natural killer lytic-associated molecule plays a role in controlling tumor dissemination and metastasis.
23085241 2012 E3 ubiquitin ligase NKLAM is a macrophage phagosome protein and plays a role in bacterial killing.
19915045 2009 Impaired NK cytolytic activity and enhanced tumor growth in NK lytic-associated molecule-deficient mice.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16709802 2006 NK lytic-associated molecule, involved in NK cytotoxic function, is an E3 ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10912506 2000 Gene structure of human and mouse NKLAM, a gene associated with cellular cytotoxicity.
More...