Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZMY6 Q8NEF8
Symbols PQWD

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

AA Sequence

MASPPRCSPTAHDRECKLPPPSAPASEYCPGKLSWGTMARALGRFKLSIPHTHLLATLDPLALDREPPPH      1 - 70
LLPEKHQVPEKLIWGDQDPLSKIPFKILSGHEHAVSTCHFCVDDTKLLSGSYDCTVKLWDPVDGSVVRDF     71 - 140
EHRPKAPVVECSITGDSSRVIAASYDKTVRAWDLETGKLLWKVRYDTFIVSCKFSPDGKYVVSGFDVDHG    141 - 210
ICIMDAENITTVSVIKDHHTRSITSCCFDPDSQRVASVSLDRCIKIWDVTSQATLLTITKAHSNAISNCC    211 - 280
FTFSGHFLCTSSWDKNLKIWNVHTGEFRNCGACVTLMQGHEGSVSSCHFARDSSFLISGGFDRTVAIWDV    281 - 350
AEGYRKLSLKGHNDWVMDVAISNNKKWILSASKDRTMRLWNIEEIDEIPLVIKYKKAVGLKLKQCERCDR    351 - 420
PFSIFKSDTSSEMFTQCVFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD                      421 - 472
//

Text Mined References (5)

PMID Year Title
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.