Property Summary

NCBI Gene PubMed Count 41
Grant Count 2
Funding $248,172.5
PubMed Score 36.47
PubTator Score 48.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q6ZMV9 Q2MDE3 Q2MDE4 Q5T8J6 Q6ZWE3 Q86T87 Q8WTV4
Symbols C6orf102
dJ137F1.4
dJ188D3.1
dJ1043E3.1

Gene

 Grant Application (2)

Gene RIF (38)

PMID Text
26443250 KIF6 polymorphism rs20455 had a significant association with Coronary Heart Disease; statin therapy was more effective in rs20455 carriers than non-carriers
25629058 KIF6 719Arg allele may increase the risk of T2DM and T2DM + CHD only in Han Chinese men by modulating lipid metabolism.
23236363 Our case-control study suggests that Trp719Arg of KIF6 gene is associated with coronary heart disease in female Han Chinese through a post hoc analysis.
23001387 KIF6 719Arg allele was not an independent risk factor for angiographic coronary artery disease(CAD)susceptibility in northern China Han populations; it was associated with a significantly higher TG level, which may indicate increased myocardial infarction risk in angiographic CAD patients
22819534 These data suggest that decreased availability of functional KLF6 contributes to clinical prostate cancer progression.
22216121 In a meta-analysis involving 144,931 participants, the KIF6 719Arg allele was not associated with the relative risk of cardiovascular disease
22192511 Assessment of KIF6 genotype is not useful in predicting low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
21943003 Discovered influence of polymorphic marker Trp719Arg of KIF6 gene on individual response to therapy with 10 mg/day of atorvastatin.
21871624 In patients with type 2 diabetes mellitus on hemodialysis, KIF6 Trp719Arg genotypes were not associated with adverse cardiovascular outcomes during follow-up or with the efficacy of atorvastatin therapy.
21810021 Carriers of the KIF6 719Arg allele were not at increased risk of CAD/non-fatal MI in a case-control study of Indians (Indo-Europeans) living in Western India.
More...

AA Sequence

MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQ      1 - 70
ETVFENIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYT     71 - 140
THISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRM    141 - 210
IAETPMNQASTRSHCIFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYL    211 - 280
EQVIIALSEKHRSHIPYRNSMMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAV    281 - 350
LNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRK    351 - 420
VHHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQ    421 - 490
EALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLSSAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQE    491 - 560
AFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEARSKIGHLKEEITQRHIQQVALGISENMAVPL    561 - 630
MPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAKVKLQKEFEVWWAEEATNLQVNSPAV    631 - 700
NSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARKILPSPCPSPHSQKQSSTSTP    701 - 770
LEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN                              771 - 814
//

Text Mined References (43)

PMID Year Title
26443250 2015 Impact of KIF6 Polymorphism rs20455 on Coronary Heart Disease Risk and Effectiveness of Statin Therapy in 100 Patients from Southern Iran.
25629058 2014 Novel KIF6 polymorphism increases susceptibility to type 2 diabetes mellitus and coronary heart disease in Han Chinese men.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23236363 2012 Meta-analyses of KIF6 Trp719Arg in coronary heart disease and statin therapeutic effect.
23001387 2012 Association of KIF6 variant with lipid level and angiographic coronary artery disease events risk in the Han Chinese population.
22819534 2012 KLF6 loss of function in human prostate cancer progression is implicated in resistance to androgen deprivation.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
22216121 2011 A common KIF6 polymorphism increases vulnerability to low-density lipoprotein cholesterol: two meta-analyses and a meta-regression analysis.
22192511 2012 KIF6, LPA, TAS2R50, and VAMP8 genetic variation, low density lipoprotein cholesterol lowering response to pravastatin, and heart disease risk reduction in the elderly.
More...