Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6ZMV5 A0A1B0GTN1 Q96M31
Symbols smk1
FLFL3P
SMEK3P
PPP4R3CP

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MAGLRYSVKVYVLNEDEEWNNLGTGQVSSTYDEQFQGMSLLVRSDSDGSVILRSQIPPDRPYGKYQETLI      1 - 70
VWYEAENQGLVLKFQDPAGCQDIWKEICQAQGKDPSIQTTVNISDEPEEDFNEMSVISNMVVLPDCELNT     71 - 140
LDQIADIVTSVFSSPVTDRERLAEILKNEAYIPKLLQLFHTCENLENTEGLHHLYEIIKGILFLNEACLF    141 - 210
EIMFSDECIMDVVGCLEYDPALDQPKRHRDFLTNDAKFKEVIPITNSELRQKIHQTYRLQYIYDILLPVP    211 - 280
SIFEDNFLSTLTTFIFSNKAEIVSMLQKDHKFLYEVFAQLKDETTHDDRRCELLFFFKELCSFSQALQPQ    281 - 350
SKDALFETLIQLGVLPALKIVMIRDDLQVRSAAAVICAYLVEYSPSRIREFIISEAHVCKDSDLFINVII    351 - 420
KQMICDTDPELGGAVHLMVVLHTLLDPRNMLTTPEKSERSEFLHFFYKHCMHKFTAPLLAATSEHNCEED    421 - 490
DIAGYDKSKNCPNDNQTAQLLALILELLTFCIQHHTFYIRSYILNKDLLRKALILMNSKHTHLILCVLRF    491 - 560
MRRMICLNDEAYNNYIIKGNLFEPVVNALLDNGTRYNMLNSAILELFEYIRVENIKPLVSHIVEKFYNTL    561 - 630
ESIEYVQTFKGLKIKYEKERDRQSQIQKNLHSVLQNIVVFRGTIEEIGLEEEICFMEDAGEVVMPPLEDD    631 - 700
DEFMETKRTQEGEAVMPPLEDDDKFTETKRTHQEGEAVMPPLEDDDEFMETKRNQEHEGKVDSPKRTSSG    701 - 770
DFKFSSSYSACAAIGTGSPSGSSVVRLVDHPDDEEEKEEDEEEKEEDKEDETSPKKKPHLSS            771 - 832
//

Text Mined References (2)

PMID Year Title