Property Summary

NCBI Gene PubMed Count 17
Grant Count 37
R01 Count 28
Funding $5,241,927.48
PubMed Score 86.86
PubTator Score 32.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.001

Gene RIF (9)

PMID Text
26306047 MG53 is a facilitator of rapid injury repair, a mediator of cell migration, and a modulator of myofibroblast differentiation during wound healing
25869134 Zn(2+) interacts with MG53 in protection against injury to the cell membrane
24344130 MG53 induces FAK ubiquitination with the aid of UBE2H during skeletal myogenesis.
23699904 MG53/TRIM72 protein can be directly applied as a therapeutic agent to increase membrane repair capacity of many cell types.
22253476 data reveal NM-IIA as a key cytoskeleton motor protein that facilitates vesicle trafficking during MG53-mediated cell membrane repair
21412170 MG53, annexin A1, and dysferlin localize to the t-tubule network and show enriched labeling at longitudinal tubules of the t-system in overstretch
21343302 membrane-delimited interaction between MG53 and PTRF contributes to initiation of cell membrane repair
19967786 Crystal structure of PRY-SPRY domain of human TRIM72.
19129174 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQ      1 - 70
LARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQL     71 - 140
QEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELG    141 - 210
SLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKM    211 - 280
FRALMPALEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVD    281 - 350
VGDKPRWALGVIAAEAPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFG    351 - 420
DGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA                 421 - 477
//

Text Mined References (18)

PMID Year Title
26306047 2015 Modulation of wound healing and scar formation by MG53 protein-mediated cell membrane repair.
25869134 2015 Zinc Binding to MG53 Protein Facilitates Repair of Injury to Cell Membranes.
25416956 2014 A proteome-scale map of the human interactome network.
24487118 2014 S-nitrosylation of TRIM72 at cysteine 144 is critical for protection against oxidation-induced protein degradation and cell death.
24344130 2014 Mitsugumin 53 (MG53) ligase ubiquitinates focal adhesion kinase during skeletal myogenesis.
23699904 2013 TRIM proteins in therapeutic membrane repair of muscular dystrophy.
23354051 2013 Central role of E3 ubiquitin ligase MG53 in insulin resistance and metabolic disorders.
22253476 2012 Nonmuscle myosin IIA facilitates vesicle trafficking for MG53-mediated cell membrane repair.
21412170 2011 Dysferlin, annexin A1, and mitsugumin 53 are upregulated in muscular dystrophy and localize to longitudinal tubules of the T-system with stretch.
21343302 2011 Polymerase transcriptase release factor (PTRF) anchors MG53 protein to cell injury site for initiation of membrane repair.
More...