Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPVRTLFPESWLWRKFTLPKSKSGISHYPISVKVPDSITTWQFVVVSLKAGQGLCVSDPFELTVMKSFFV      1 - 70
DLKLPSSVIRNEQVQIQAMLYNFRDRQAKVRVEFPHKETLCSASKPGAPSHQAGVQIQQTSYSIVLEPQG     71 - 140
QTQTKLVPRQEFLNMVPDTEAEVFISVQGYTQMLTHRSSDGTYHTSKGNPGSTWLTSYVFRVFALAYSMM    141 - 210
TTQVLSLSSLCDMANWIIIDRQAEDGHFLEKGPVVMTSMQDGYQGSEEDVSLTALVLIALNEGKELCRQK    211 - 280
NLMASIERARGFLERKLPDIQTTFAVAIASYALALANSSQANDCLDSFASPSGCGMLLNQPQSWSGEGVI    281 - 350
SNPAMCYSSLSVS                                                             351 - 363
//

Text Mined References (6)

PMID Year Title