Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Synonym

Accession Q6ZMU1
Symbols CPLP

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MPVRTLFPESWLWRKFTLPKSKSGISHYPISVKVPDSITTWQFVVVSLKAGQGLCVSDPFELTVMKSFFV      1 - 70
DLKLPSSVIRNEQVQIQAMLYNFRDRQAKVRVEFPHKETLCSASKPGAPSHQAGVQIQQTSYSIVLEPQG     71 - 140
QTQTKLVPRQEFLNMVPDTEAEVFISVQGYTQMLTHRSSDGTYHTSKGNPGSTWLTSYVFRVFALAYSMM    141 - 210
TTQVLSLSSLCDMANWIIIDRQAEDGHFLEKGPVVMTSMQDGYQGSEEDVSLTALVLIALNEGKELCRQK    211 - 280
NLMASIERARGFLERKLPDIQTTFAVAIASYALALANSSQANDCLDSFASPSGCGMLLNQPQSWSGEGVI    281 - 350
SNPAMCYSSLSVS                                                             351 - 363
//

Text Mined References (6)

PMID Year Title
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.