Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.81
PubTator Score 5.39

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.59206923096214E-27
Amyotrophic Lateral Sclerosis 432 8.98662418576549E-9
acute quadriplegic myopathy 1157 1.13178449398409E-6
sonic hedgehog group medulloblastoma 1482 1.36685794707535E-4
osteosarcoma 7933 1.72627091696093E-4
lung cancer 4473 0.00154360029292159
diabetes mellitus 1663 0.0016869798869645
mucosa-associated lymphoid tissue lymphoma 480 0.00685690429337047
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0145760416744123
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0199186924683779
invasive ductal carcinoma 2950 0.0222407948706478
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0229435943379201
Disease Target Count Z-score Confidence
Ossifying fibroma 13 3.737 1.9



Accession Q6ZMT4 A4D1S9 C9JJH9 C9JQU2 Q6MZL8 Q9C0E5
Symbols JHDM1D



3KV5   3KV6   3KV9   3KVA   3KVB   3U78  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (4)

26608785 Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome.
22143793 increased JHDM1D expression suppresses tumor growth by down-regulating angiogenesis under nutrient starvation
20084082 KIAA1718 is a dual-specificity histone demethylase that regulates neural differentiation through FGF4.
18187620 Knockdown of jumonji C domain containing histone demethylase 1 homolog D (JHDM1D) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

GKRPKKGMATAKQRLGKILKLNRNGHARFFV                                           911 - 941

Text Mined References (14)

PMID Year Title
26608785 2015 Histone Modifier Genes Alter Conotruncal Heart Phenotypes in 22q11.2 Deletion Syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22143793 2011 Increased expression of histone demethylase JHDM1D under nutrient starvation suppresses tumor growth via down-regulating angiogenesis.
20622853 2010 Histone H4K20/H3K9 demethylase PHF8 regulates zebrafish brain and craniofacial development.
20194436 2010 KDM7 is a dual demethylase for histone H3 Lys 9 and Lys 27 and functions in brain development.
20084082 2010 Dual-specificity histone demethylase KIAA1718 (KDM7A) regulates neural differentiation through FGF4.
20023638 2010 Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.