Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.02
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
Breast cancer 3578 3.4e-20
osteosarcoma 7950 1.4e-09
ovarian cancer 8520 1.5e-04
breast carcinoma 1638 3.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Asthma 385 0.0 3.0
Disease Target Count Z-score Confidence
Native American myopathy 4 6.058 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.300 3.4e-20
breast carcinoma -2.100 3.3e-03
osteosarcoma 2.702 1.4e-09
ovarian cancer -1.200 1.5e-04

Gene RIF (1)

AA Sequence

MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTP      1 - 70
PTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLR     71 - 140
CKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRY    141 - 210
GTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQ    211 - 280
QLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVR    281 - 350
PGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI             351 - 411
//

Text Mined References (8)

PMID Year Title