Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.3e-10

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.155 1.3e-10

AA Sequence

MVRPQDTVAYEDLSEDYTQKKWKGLALSQRALHWNMMLENDRSMASLGRNMMESSELTPKQEIFKGSESS      1 - 70
NSTSGGLFGVVPGGTETGDVCEDTFKELEGQPSNEEGSRLESDFLEIIDEDKKKSTKDRYEEYKEVEEHP     71 - 140
PLSSSPVEHEGVLKGQKSYRCDECGKAFYWSSHLIGHRRIHTGEKPYECNECGKTFRQTSQLIVHLRTHT    141 - 210
GEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFNQSSKLFDHQRTHTGEKPYECKECGAAF    211 - 280
SRSKNLVRHQFLHTGKKPYKCNECGRAFCSNRNLIDHQRTHTGEKPYKCNECGKAFSRSKCLIRHQSLHT    281 - 350
GEKPYKCSECGKAFNQISQLVEHERIHTGEKPFKCSECGKAFGLSKCLIRHQRLHTSEKPYKCNECGKSF    351 - 420
NQNSYLIIHQRIHTGEKPYECNECGKVFSYNSSLMVHQRTHTGEKPYKCNSCGKAFSDSSQLTVHQRVHT    421 - 490
GEKNLMNVLSVGKPLVSVPLLITTSELMLERSPQVWLGHLLKAWFSETDSKDL                     491 - 543
//

Text Mined References (4)

PMID Year Title