Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $564,481.5
PubMed Score 32.15
PubTator Score 16.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 7.100 0.000

Gene RIF (11)

PMID Text
23869757 ECRG1 Arg290Gln polymorphism significantly affects the susceptibility but not the prognosis of esophageal squamous cell carcinoma patients in low-risk north Indian population.
23548972 This suggests that substitution of the arginine in the conserved catalytic domain of the ECRG1 protein might reduce its catalytic capacity by impacting its 3-dimensional conformation, thereby causing the genetic susceptibility to ESCC. [review]
23481570 Data show that the allele types of ECRG1 were Arg/Arg (54.2%), Arg/Gln (45.8%) and Gln/Gln (0.00%), and the allele types of FGFR4 amino acid 388 were Arg/Arg (8.3%), Arg/Gly (54.2%) and Gly/Gly (37.5%).
21517269 A statistically significantly increased risk of ESCC was found to be associated with the ECRG1 Arg/Gln and Gln/Gln genotype.
21288367 Data show that ECRG4 interacts directly with ECRG1 to upregulate p21 protein expression, induce cell cycle G1 phase block and inhibit cancer cells proliferation in ESCC.
19826048 Observational study of gene-disease association. (HuGE Navigator)
19394797 no significant association between single nucleotide polymorphisms Arg/Arg, Arg/Gln and Gln/Gln and survival in oral squamous cell carcinoma
19394797 Observational study of gene-disease association. (HuGE Navigator)
19052822 DNA polymorphisms in the coding region of ECRG1 are associated with poor outcome after surgical resection in esophageal carcinoma.
19052822 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MMYRTVGFGTRSRNLKPWMIAVLIVLSLTVVAVTIGLLVHFLVFDQKKEYYHGSFKILDPQINNNFGQSN      1 - 70
TYQLKDLRETTENLVSQVDEIFIDSAWKKNYIKNQVVRLTPEEDGVKVDVIMVFQFPSTEQRAVREKKIQ     71 - 140
SILNQKIRNLRALPINASSVQVNAMSSSTGELTVQASCGKRVVPLNVNRIASGVIAPKAAWPWQASLQYD    141 - 210
NIHQCGATLISNTWLVTAAHCFQKYKNPHQWTVSFGTKINPPLMKRNVRRFIIHEKYRSAAREYDIAVVQ    211 - 280
VSSRVTFSDDIRRICLPEASASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDI    281 - 350
KPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTG    351 - 420
I//

Text Mined References (18)

PMID Year Title
23869757 2013 Modification of risk, but not survival of esophageal cancer patients by esophageal cancer-related gene 1 Arg290Gln polymorphism: a case-control study and meta-analysis.
23548972 2013 ECRG1 and its relationship with esophageal cancer: a brief review.
23481570 ECRG1 and FGFR4 single nucleotide polymorphism as predictive factors for nodal metastasis in oral squamous cell carcinoma.
21517269 2011 The ECRG1 290Arg/Gln polymorphism is related to risk of esophageal squamous cell carcinoma in Kashmir.
21288367 2011 A novel tumor suppressor gene ECRG4 interacts directly with TMPRSS11A (ECRG1) to inhibit cancer cell growth in esophageal carcinoma.
19826048 2009 Candidate gene association study of esophageal squamous cell carcinoma in a high-risk region in Iran.
19394797 2009 Single nucleotide polymorphism in esophageal cancer related gene 1: an analysis in resected oral squamous cell carcinoma patients.
19052822 2009 Polymorphism Arg290Arg in esophageal-cancer-related gene 1 (ECRG1) is a prognostic factor for survival in esophageal cancer.
17971341 2008 ECRG1, a novel esophageal gene, cloned and identified from human esophagus and its inhibition effect on tumors.
16267096 2006 Identification of a novel polymorphism Arg290Gln of esophageal cancer related gene 1 (ECRG1) and its related risk to esophageal squamous cell carcinoma.
More...