Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.01
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZMR3 D3DQY5
Symbols LDH6A

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
18351441 expression of LDHAL6A was able to activate transcriptional activities of AP1(PMA)

AA Sequence

MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSP      1 - 70
FMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPV     71 - 140
DILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVP    141 - 210
LKDLNPDIGTDKDPEQWENVHKKVISSGYEMVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGL    211 - 280
YGINEDIFLSVPCILGENGITDLIKVKLTLEEEACLQKSAETLWEIQKELKL                      281 - 332
//

Text Mined References (4)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18351441 2009 Identification of a novel human lactate dehydrogenase gene LDHAL6A, which activates transcriptional activities of AP1(PMA).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.