Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.99
PubTator Score 11.93

Knowledge Summary

Patent (2,674)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.300 2.6e-07
ependymoma -1.200 1.8e-02
glioblastoma -1.100 1.9e-08
intraductal papillary-mucinous adenoma (... -1.100 1.6e-03
intraductal papillary-mucinous carcinoma... -1.100 7.0e-03
lung adenocarcinoma -2.600 2.8e-10
lung cancer -1.200 4.2e-03
medulloblastoma -1.100 3.9e-08
medulloblastoma, large-cell -1.200 1.3e-03
osteosarcoma 1.652 4.7e-04
pediatric high grade glioma -1.300 2.1e-10
primitive neuroectodermal tumor -1.200 2.7e-04
psoriasis 1.700 7.9e-05
subependymal giant cell astrocytoma -1.336 3.6e-02

Gene RIF (4)

AA Sequence

MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGIGFKEFENAEG      1 - 70
DEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSLLYLKEIGRGWFGKVF     71 - 140
LGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFCPLGDL    141 - 210
KGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYR    211 - 280
EDYFVTADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYT    281 - 350
VREQQLKLPKPQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPG    351 - 420
GGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAF    421 - 490
PATLSPGRTARLQELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQ    491 - 560
DDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLARDPLCPSRSPSPSAGPLSLAEGGAEDADWG    561 - 630
VAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVS    631 - 700
AGGHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETAS    701 - 770
SGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKL    771 - 840
ASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPS    841 - 910
SASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLS    911 - 980
TSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLRPGVSGEAQGS    981 - 1050
GPGEVLPPLLQLEGSSPEPSTCPSGLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGP   1051 - 1120
PGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAALEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEE   1121 - 1190
APAVPVVVAESQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAK   1191 - 1260
ESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPAAPTPT   1261 - 1330
PAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA                             1331 - 1374
//

Text Mined References (19)

PMID Year Title