Property Summary

NCBI Gene PubMed Count 22
PubMed Score 3.69
PubTator Score 3.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -3.400 2.1e-08
chronic rhinosinusitis -1.760 1.8e-03
cystic fibrosis 1.231 6.5e-05
fibroadenoma 2.200 7.9e-03
group 3 medulloblastoma -1.900 2.8e-03
interstitial cystitis -1.400 4.5e-03
invasive ductal carcinoma -1.153 4.3e-02
lung adenocarcinoma -1.400 1.6e-08
malignant mesothelioma -1.400 2.2e-04
medulloblastoma, large-cell -1.200 4.8e-03
ovarian cancer 1.400 5.5e-04
pancreatic cancer 1.300 1.4e-02
posterior fossa group A ependymoma 1.200 1.6e-02
primary pancreatic ductal adenocarcinoma 1.186 1.0e-02

 CSPA Cell Line (1)

Gene RIF (10)

AA Sequence

MVSHFMGSLSVLCFLLLLGFQFVCPQPSTQHRKVPQRMAAEGAPEDDGGGGAPGVWGAWGPWSACSRSCS      1 - 70
GGVMEQTRPCLPRSYRLRGGQRPGAPARAFADHVVSAVRTSVPLHRSRDETPALAGTDASRQGPTVLRGS     71 - 140
RHPQPQGLEVTGDRRSRTRGTIGPGKYGYGKAPYILPLQTDTAHTPQRLRRQKLSSRHSRSQGASSARHG    141 - 210
YSSPAHQVPQHGPLYQSDSGPRSGLQAAEAPIYQLPLTHDQGYPAASSLFHSPETSNNHGVGTHGATQSF    211 - 280
SQPARSTAISCIGAYRQYKLCNTNVCPESSRSIREVQCASYNNKPFMGRFYEWEPFAEVKGNRKCELNCQ    281 - 350
AMGYRFYVRQAEKVIDGTPCDQNGTAICVSGQCKSIGCDDYLGSDKVVDKCGVCGGDNTGCQVVSGVFKH    351 - 420
ALTSLGYHRVVEIPEGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEI    421 - 490
SSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPHRRPGEPFNGQMVTEGRSQEE    491 - 560
GEQKGRNEEKEDLRGEAPEMFTSESAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECS    561 - 630
TTCGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQ    631 - 700
VLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDV    701 - 770
VDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPA    771 - 840
EATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEKPPSQQSCHLK    841 - 910
PCGAKWFSTEWSMCSKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEERESCNPQDCVPEVDENCKDKYY    911 - 980
NCNVVVQARLCVYNYYKTACCASCTRVANRQTGFLGSR                                    981 - 1018
//

Text Mined References (25)

PMID Year Title