Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.65
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6ZMN8 B2RNE2 B7ZMB7 B7ZMB8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASGAQLPPQPSSSEVSAVQSPGGRPGAGLEETALGVPLPPSPGEAPLPRSNRSRCPGTRQPGAASLHAA      1 - 70
SAAVPVRPRRGTAPAGKTADAVPAAAPEQAPRPAPQSRKPRNLEGDLDERRLLCHLQLAQDREARLWRGG     71 - 140
KPQDEICDAFEEVVLWLLRLQNTFYFSQSTFNLALTIFGRLLISVKVKEKYLHCATITSLRLAAKVNEEE    141 - 210
EFIPQVKDFTKHYGSDYSPNELLRMELAILDRLHWDLYIGTPLDFLTIFHALVVLSWPHVLELLPQRNPS    211 - 280
LHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELERLMPGWCAPISDLLKKAQVGDMQYSCCKELVMQ    281 - 350
QLRSLQSSSCTDNFVSPAN                                                       351 - 369
//

Text Mined References (4)

PMID Year Title