Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.34
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.900 0.000
periodontitis 1.300 0.000
primitive neuroectodermal tumor 1.600 0.019
Atopic dermatitis -1.100 0.005
colon cancer -3.100 0.000
group 3 medulloblastoma -1.700 0.024
subependymal giant cell astrocytoma -1.584 0.019
ovarian cancer -1.500 0.000
pituitary cancer 2.700 0.000

Gene RIF (2)

PMID Text
26486104 Results showed that PDZRN4 might be a potential tumour suppressor gene and had anti-proliferative effect on hepatocellular carcinoma cell proliferation.
20944657 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGFALERFAEAVDPALECKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRRCPLQCQPLAPGELYRVLPL      1 - 70
RSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRGGCASGLGGGEVPARGGCGPTPRAG     71 - 140
RGGGARGGPPGGRWGRGRGPGPRVLAWRRREKALLAQLWALQGEVQLTARRYQEKFTQYMAHVRNFVGDL    141 - 210
GGGHRRDGEHKPFTIVLERENDTLGFNIIGGRPNQNNQEGTSTEGIYVSKILENGPADRADGLEIHDKIM    211 - 280
EVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLR    281 - 350
PPTPPVPDICPFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCY    351 - 420
RTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECKRIVLLVARPEIQL    421 - 490
DEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRTDE    491 - 560
SLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVELQYNESLVSGEYIDSDCIGNPDEDCERFRQL    561 - 630
LELKCKIRNHGEYDLYYSSSTIECNQGEQEGVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIW    631 - 700
TLHDGGFRNYNTSIDMQRGKLDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDSSLPRVINLTNKK    701 - 770
NLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRY    771 - 840
ANIPAHARHYQSYMQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRI    841 - 910
LKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSGSE    911 - 980
GKKEINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV                  981 - 1036
//

Text Mined References (13)

PMID Year Title
26486104 2015 PDZRN4 acts as a suppressor of cell proliferation in human liver cancer cell lines.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010864 2004 Identification and characterization of PDZRN3 and PDZRN4 genes in silico.
More...