Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.67
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Silicosis 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.4
Disease Target Count Z-score Confidence
Rectum adenocarcinoma 8 3.412 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.100 4.7e-03
colon cancer -3.100 5.7e-10
group 3 medulloblastoma -1.700 2.4e-02
ovarian cancer -1.500 5.6e-06
periodontitis 1.300 3.7e-22
pituitary cancer 2.700 1.6e-04
primitive neuroectodermal tumor 1.600 1.9e-02
psoriasis -1.100 1.1e-02
subependymal giant cell astrocytoma -1.584 1.9e-02

Gene RIF (2)

AA Sequence

MGFALERFAEAVDPALECKLCGQVLEEPLCTPCGHVFCASCLLPWAVRRRRCPLQCQPLAPGELYRVLPL      1 - 70
RSLIQKLRVQCDYRARGCGHSVRLHELEAHVEHCDFGPARRLRSRGGCASGLGGGEVPARGGCGPTPRAG     71 - 140
RGGGARGGPPGGRWGRGRGPGPRVLAWRRREKALLAQLWALQGEVQLTARRYQEKFTQYMAHVRNFVGDL    141 - 210
GGGHRRDGEHKPFTIVLERENDTLGFNIIGGRPNQNNQEGTSTEGIYVSKILENGPADRADGLEIHDKIM    211 - 280
EVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSRPAYGMASEVQLMNASTQTDITFEHIMALAKLR    281 - 350
PPTPPVPDICPFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCY    351 - 420
RTDDEEDTGIYVSEVDPNSIAAKDGRIREGDRILQINGEDVQNREEAVALLSNDECKRIVLLVARPEIQL    421 - 490
DEGWLEDERNEFLEELNLEMLEEEHNEAMQPTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRTDE    491 - 560
SLRNDESSEQENAAEDPNSTSLKSKRDLGQSQDTLGSVELQYNESLVSGEYIDSDCIGNPDEDCERFRQL    561 - 630
LELKCKIRNHGEYDLYYSSSTIECNQGEQEGVEHELQLLNEELRNIELECQNIMQAHRLQKVTDQYGDIW    631 - 700
TLHDGGFRNYNTSIDMQRGKLDDIMEHPEKSDKDSSSAYNTAESCRSTPLTVDRSPDSSLPRVINLTNKK    701 - 770
NLRSTMAATQSSSGQSSKESTSTKAKTTEQGCSAESKEKVLEGSKLPDQEKAVSEHIPYLSPYHSSSYRY    771 - 840
ANIPAHARHYQSYMQLIQQKSAVEYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRI    841 - 910
LKERALKIKEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSGSE    911 - 980
GKKEINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV                  981 - 1036
//

Text Mined References (13)

PMID Year Title