Property Summary

NCBI Gene PubMed Count 7
PubMed Score 23.54
PubTator Score 4.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.3e-04
osteosarcoma 7950 7.2e-04
Disease Target Count Z-score Confidence
Proctitis 13 3.215 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 2.3e-04
osteosarcoma -1.208 7.2e-04

AA Sequence

MAPKPGAEWSTALSHLVLGVVSLHAAVSTAEASRGAAAGFLLQVLAATTTLAPGLSTHEDCLAGAWVATV      1 - 70
IGLPLLAFDFHWCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECG     71 - 140
FCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSH    141 - 210
RKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCK    211 - 280
RTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKN    281 - 350
INLRLFLFQIQK                                                              351 - 362
//

Text Mined References (8)

PMID Year Title